New window

ID: GDB144193A_223972677

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB144193A_223972677
         (426 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|116579 pfam07969, Amidohydro_3, Amidohydrolase family.         63   4e-11
gnl|CDD|110931 pfam01979, Amidohydro_1, Amidohydrolase family.  ...    57   3e-09

>gnl|CDD|116579 pfam07969, Amidohydro_3, Amidohydrolase family. 
          Length = 392

 Score = 62.9 bits (153), Expect = 4e-11
 Identities = 72/311 (23%), Positives = 101/311 (32%), Gaps = 56/311 (18%)

Query: 114 QAGGGIHFTVERTRQATEEELFRSLQQRLQCMMRAG-TTLVECKSGYGLDLETELKMLRV 172
            A   +         A   E+ R L+  +  +   G TT  +         E     L  
Sbjct: 107 NAFVDLGLGALPATLADIAEMARILRAAIVELNALGITTGHDGAGFEAGPAEL----LAA 162

Query: 173 IERARRELDIGISATYCGAHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVF 232
           +     E   G+     GA   P G+TA     D  +         G   +I  D I   
Sbjct: 163 LRALAAEGKGGVKIFVDGA---PGGRTALLELPDYADKP-------GAPIDISGDPI--- 209

Query: 233 CEKGVFDLDSTRRILQRGKDIGLQINFHG------DELHPMKAAELGAELGAQAISHLEE 286
                 D +    ++      GLQ+  H       D +     A L        + H   
Sbjct: 210 -----DDAEELEELVAAAHAAGLQVRVHASGDAAIDAVLNAYEAVLADLGR---LIHAGV 261

Query: 287 VSDEGIVAMATARCSAILLPTT------AYMLRLKQPRAR------KMLDEGVIVALGSD 334
            + + I   A     A   P            RL   RAR       +L+ GV VALGSD
Sbjct: 262 ATTDTIDRAAELGLRADTQPHFLAYDGYWDRSRLGPERARGSLPIKLLLNAGVKVALGSD 321

Query: 335 -----FNP--NAYCFSMPMVMHLACVNM-----RMSMPEALAAATINAAYALGKSHTHGS 382
                ++P        M     +    +     R+S+ EALA  T   AYALG     G+
Sbjct: 322 APVATYDPWSGIGAAVMRRTAEMLEGRVLKPDERLSLEEALALYTRGPAYALGLEDRKGT 381

Query: 383 LEVGKQGDLII 393
           L VGK  DL+I
Sbjct: 382 LAVGKDADLVI 392


>gnl|CDD|110931 pfam01979, Amidohydro_1, Amidohydrolase family.  This family of
           enzymes are a a large metal dependent hydrolase
           superfamily. The family includes Adenine deaminase
           EC:3.5.4.2 that hydrolyses adenine to form hypoxanthine
           and ammonia. Adenine deaminases reaction is important
           for adenine utilisation as a purine and also as a
           nitrogen source. This family also includes
           dihydroorotase and N-acetylglucosamine-6-phosphate
           deacetylases, EC:3.5.1.25 These enzymes catalyse the
           reaction N-acetyl-D-glucosamine 6-phosphate + H2O <=>
           D-glucosamine 6-phosphate + acetate. This family
           includes the catalytic domain of urease alpha subunit.
           Dihydroorotases (EC:3.5.2.3) are also included.
          Length = 319

 Score = 56.5 bits (136), Expect = 3e-09
 Identities = 65/341 (19%), Positives = 98/341 (28%), Gaps = 47/341 (13%)

Query: 79  ILPGLVDAHTHPVWAGERVHEFAMKLAGATYMEIHQAGGGIHFTVERTRQATEEELFRSL 138
           +LPGL+DAH H      R  +                  G    ++    A  +   R  
Sbjct: 2   VLPGLIDAHVHLESPLLRGDDSY---EAILTGAKAMLRSGTTTVLDTPTSANTDGKLRKE 58

Query: 139 QQRLQCMMRAGTTLVECKSGYGLD--------------LETELKMLRVIERARRE-LDIG 183
                  + A   L                        +E    ++++I  A +    I 
Sbjct: 59  IME---GLVAAPKLKPNVELLLKGSVGGRAELGEVPMVIEAGADLIKIIADAGKTAKAID 115

Query: 184 ISATYCGAHSVPKGKTAT------EAADDIINNHLPKLK--ELGRNGEIHVDNIDVFCEK 235
                   H                A +  +   L  L             D  +     
Sbjct: 116 GVLPALAPHDPQTVSHEGLKNEVELAEETEVAEKLGLLVHIHAAEASGEVEDVEETKGSV 175

Query: 236 GVFDLDSTRRILQRGKDIGLQINFHGDELHPMKAAELGAELGAQAIS-HLEEVSDEGIVA 294
            V  LD    +    K  GL +  H   LH       G+ +    +S             
Sbjct: 176 PVERLDHLLLLKNAIKG-GLDLLAHC--LHLDDEEIAGSGIAHCPLSNESILHRGGRFSL 232

Query: 295 MATARCSAILLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHLACVN 354
           M+        L +    L      A +    GV V LG+D   +   F +          
Sbjct: 233 MSGDAQGIGRLGSGGARLARL---ADEA---GVNVGLGTDGGASGKLFYL--------DP 278

Query: 355 MRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIIN 395
             +S  EAL  ATIN A ALG     GS+EVGK  DL++++
Sbjct: 279 DNLSPIEALRMATINPAKALGLDDRVGSIEVGKDADLVVVD 319


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.321    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0646    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 3,592,304
Number of extensions: 339990
Number of successful extensions: 326
Number of sequences better than  1.0: 1
Number of HSP's gapped: 322
Number of HSP's successfully gapped: 4
Length of query: 426
Length of database: 1,940,249
Length adjustment: 87
Effective length of query: 339
Effective length of database: 1,040,669
Effective search space: 352786791
Effective search space used: 352786791
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (27.8 bits)