New window

ID: GDB1992A_13489087

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB1992A_13489087
         (379 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109147 pfam00079, Serpin, Serpin (serine protease inhibi...   438   e-124

>gnl|CDD|109147 pfam00079, Serpin, Serpin (serine protease inhibitor).  Structure
           is a multi-domain fold containing a bundle of helices
           and a beta sandwich.
          Length = 376

 Score =  438 bits (1129), Expect = e-124
 Identities = 170/381 (44%), Positives = 228/381 (59%), Gaps = 15/381 (3%)

Query: 3   QLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNT 62
           +L+SANT FA  L+  L E +P  NIF SP SISSA+AM+ LG +GNT  Q+ +   FN 
Sbjct: 7   KLASANTDFAFSLYKQLVEKSPDKNIFFSPVSISSALAMLSLGAKGNTRTQILEVLGFNL 66

Query: 63  VE----EVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLAS 118
            E    E+H  FQ L  ++N+      L   N L+ +K+   L  FL   +K Y +++ S
Sbjct: 67  TETSEAEIHQGFQHLLQELNRPDTGLQLTTGNALFVDKSLKLLDSFLEDVKKLYQSEVFS 126

Query: 119 VDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKE 178
           VDF    E+A+K IN WV+ +T+GKI +LL+   +D+ T LVLVN IYFKG WK  F  E
Sbjct: 127 VDFSD-PEEAKKQINDWVEKKTQGKIKDLLSD--LDSDTVLVLVNYIYFKGKWKKPFDPE 183

Query: 179 ATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIED 238
            T    F ++KK    V MM Q   F Y   E+L C+VLELPY+G   +M ILLP D   
Sbjct: 184 NTREEDFHVDKKTTVKVPMMSQTGTFRYFRDEELNCKVLELPYKGNATAMFILLPPD--- 240

Query: 239 ESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFN 298
               L+++E  LT E L +W   +N+    V + LP+F +  SY L   LA+LG+ DLF 
Sbjct: 241 -EGKLEQVEAALTPETLRKW--LKNMTPRSVELYLPKFSISGSYDLKDVLAKLGITDLF- 296

Query: 299 SSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPF 358
           S +ADLSG+S   D+ +SK VHK+ +EV+EEGTEAAAATA        +P   F  D PF
Sbjct: 297 SEEADLSGISEDEDLKVSKAVHKAVLEVDEEGTEAAAATAAEIVP-RSLPPTVFKFDRPF 355

Query: 359 LFFIRHNSSGSILFLGRFSSP 379
           LF I  N +GSILF+G+  +P
Sbjct: 356 LFLIYENPTGSILFMGKVVNP 376


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.318    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0765    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 3,215,406
Number of extensions: 302090
Number of successful extensions: 257
Number of sequences better than  1.0: 1
Number of HSP's gapped: 250
Number of HSP's successfully gapped: 1
Length of query: 379
Length of database: 1,940,249
Length adjustment: 86
Effective length of query: 293
Effective length of database: 1,051,009
Effective search space: 307945637
Effective search space used: 307945637
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (27.6 bits)