New window

ID: GDB23411A_7657575

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB23411A_7657575
         (747 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|111079 pfam02146, SIR2, Sir2 family.  This region is cha...   256   4e-69
gnl|CDD|114251 pfam05518, Totivirus_coat, Totivirus coat protein.      39   0.001
gnl|CDD|113810 pfam05053, Menin, Menin.  MEN1, the gene responsi...    35   0.019
gnl|CDD|111992 pfam03155, Alg6_Alg8, ALG6, ALG8 glycosyltransfer...    32   0.16 
gnl|CDD|111005 pfam02063, MARCKS, MARCKS family.                       31   0.23 
gnl|CDD|117636 pfam09073, BUD22, BUD22.  BUD22 has been shown in...    31   0.25 
gnl|CDD|118020 pfam09483, HpaP, Type III secretion protein (HpaP...    31   0.30 
gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MI...    31   0.36 
gnl|CDD|109956 pfam00921, Lipoprotein_2, Borrelia lipoprotein.  ...    30   0.55 
gnl|CDD|114438 pfam05712, MRG, MRG.  This family consists of thr...    30   0.82 

>gnl|CDD|111079 pfam02146, SIR2, Sir2 family.  This region is characteristic of
           Silent information regulator 2 (Sir2) proteins, or
           sirtuins. These are protein deacetylases that depend on
           nicotine adenine dinucleotide (NAD). They are found in
           many subcellular locations, including the nucleus,
           cytoplasm and mitochondria. Eukaryotic forms play in
           important role in the regulation of transcriptional
           repression. Moreover, they are involved in microtubule
           organisation and DNA damage repair processes.
          Length = 174

 Score =  256 bits (656), Expect = 4e-69
 Identities = 89/184 (48%), Positives = 119/184 (64%), Gaps = 10/184 (5%)

Query: 261 GAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQ 320
           GAG+S   GIPDFRS DG+YA+LA +  +L  P+A F   Y   DP  F+  A+E+ PGQ
Sbjct: 1   GAGISTESGIPDFRSDDGLYAKLAKE--ELASPEAFFSNPYLVWDP--FYNIARELLPGQ 56

Query: 321 FQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDC 380
            QP+  H FIA  + +GKLLR  TQNID L + AG +++++ HGSFA A C+ C  K   
Sbjct: 57  AQPNPAHYFIAELEDKGKLLRLITQNIDGLHERAGSKKVVELHGSFAKARCVSCHKKYTG 116

Query: 381 EAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIG 440
           E +   I    VP+C +C       ++KP+IVFFGENLP++F  A + D +E DLLIVIG
Sbjct: 117 ETLPERIDAAKVPKCDKCG-----GLLKPDIVFFGENLPDKFFEAYE-DVEEADLLIVIG 170

Query: 441 SSLK 444
           +SLK
Sbjct: 171 TSLK 174


>gnl|CDD|114251 pfam05518, Totivirus_coat, Totivirus coat protein. 
          Length = 753

 Score = 39.4 bits (92), Expect = 0.001
 Identities = 29/101 (28%), Positives = 35/101 (34%), Gaps = 7/101 (6%)

Query: 4   EAALALQPGGSPSAAGADREAASSPA-GEPLRKRP---RRDGPGLERSPGEPGG---AAP 56
           EA     PG  P    A     S  A G+P+R          P   R  G PGG     P
Sbjct: 653 EAGGPGVPGPVPVGMPAHTARPSRVARGDPVRPTAHHAALRAPQAPRPGGPPGGGGGLPP 712

Query: 57  EREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAA 97
             ++PAAA   P  ++      A  E    G EQ   A   
Sbjct: 713 PPDLPAAAGPAPCGSSLIASPTAPPEPEPPGAEQADGAENQ 753



 Score = 32.8 bits (75), Expect = 0.092
 Identities = 19/102 (18%), Positives = 22/102 (21%), Gaps = 16/102 (15%)

Query: 16  SAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAAL 75
                 + A   P      +      PG          A P R     ARG P       
Sbjct: 634 GFPPVFKTALPRPDYNRGGEAGGPGVPGPVPVGMPAHTARPSRV----ARGDP------- 682

Query: 76  WREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLA 117
                    A      A      G    G G   P  + P A
Sbjct: 683 -----VRPTAHHAALRAPQAPRPGGPPGGGGGLPPPPDLPAA 719


>gnl|CDD|113810 pfam05053, Menin, Menin.  MEN1, the gene responsible for multiple
           endocrine neoplasia type 1, is a tumour suppressor gene
           that encodes a protein called Menin which may be an
           atypical GTPase stimulated by nm23.
          Length = 618

 Score = 35.0 bits (80), Expect = 0.019
 Identities = 29/98 (29%), Positives = 37/98 (37%), Gaps = 11/98 (11%)

Query: 21  DREAASS--PAGEPLRKRPRRDGPGLERSPGEP-GGAAPEREVPAAARGCPGAAAAALWR 77
           ++EA  S   AGE  R+  RR GP  E    EP GG +P  E+PA       +       
Sbjct: 461 EKEAKESKEAAGEEAREGRRR-GPRRESKSQEPSGGESPNPELPANNNN-SNSNNNNNNG 518

Query: 78  EAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPP 115
               EAAA  G       A      +G  +  P    P
Sbjct: 519 ADRKEAAATTG------NATTTSNGSGTSVPLPVSSEP 550


>gnl|CDD|111992 pfam03155, Alg6_Alg8, ALG6, ALG8 glycosyltransferase family.
           N-linked (asparagine-linked) glycosylation of proteins
           is mediated by a highly conserved pathway in eukaryotes,
           in which a lipid (dolichol phosphate)-linked
           oligosaccharide is assembled at the endoplasmic
           reticulum membrane prior to the transfer of the
           oligosaccharide moiety to the target asparagine
           residues. This oligosaccharide is composed of
           Glc(3)Man(9)GlcNAc(2). The addition of the three glucose
           residues is the final series of steps in the synthesis
           of the oligosaccharide precursor. Alg6 transfers the
           first glucose residue, and Alg8 transfers the second
           one. In the human alg6 gene, a C->T transition, which
           causes Ala333 to be replaced with Val, has been
           identified as the cause of a congenital disorder of
           glycosylation, designated as type Ic OMIM:603147.
          Length = 463

 Score = 32.0 bits (73), Expect = 0.16
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 178 PRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPE-LDDMTLWQIVINILS 229
              RI  +   Q   +IG  P  I    L   +PPP+   D  LW ++ ++ S
Sbjct: 400 YLKRIFLFNISQILYIIGLIPIVIYLHFLDLFVPPPQKYPD--LWLLLNSVYS 450


>gnl|CDD|111005 pfam02063, MARCKS, MARCKS family. 
          Length = 296

 Score = 31.3 bits (70), Expect = 0.23
 Identities = 29/111 (26%), Positives = 38/111 (34%)

Query: 4   EAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAA 63
           E A A + G    AA A  EA S        +     G   E        A PE+     
Sbjct: 167 EGAAAEKEGAKEEAAAAAPEAGSGEEAAAPGEEAGAAGAEGEAGEEPAADAEPEQPEAKP 226

Query: 64  ARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREP 114
               P    A   + AE + A     +EA A++AA E         P+ EP
Sbjct: 227 EEAAPEKPQAEEAKAAEEQKAEEKPAEEAGASSAAQEAPAAEQEAAPAEEP 277



 Score = 31.0 bits (69), Expect = 0.30
 Identities = 35/143 (24%), Positives = 49/143 (34%), Gaps = 15/143 (10%)

Query: 14  SPSAAGADREAASSPAGEPLRKRPRR---------DGPGLERSPGEPGGAAPEREVPAAA 64
           + S   A+  A  SP+ E  +K+ +R          G   +++  E G  A      A  
Sbjct: 114 ATSTEKAEDGATPSPSSETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGAEAEGAAAEK 173

Query: 65  RGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGP------SREPPLAD 118
            G    AAAA       E AAA GE+   A A    G+       P        E     
Sbjct: 174 EGAKEEAAAAAPEAGSGEEAAAPGEEAGAAGAEGEAGEEPAADAEPEQPEAKPEEAAPEK 233

Query: 119 NLYDEDDDDEGEEEEEAAAAAIG 141
              +E    E ++ EE  A   G
Sbjct: 234 PQAEEAKAAEEQKAEEKPAEEAG 256


>gnl|CDD|117636 pfam09073, BUD22, BUD22.  BUD22 has been shown in yeast to be a
           nuclear protein involved in bud-site selection. It plays
           a role in positioning the proximal bud pole signal.
          Length = 432

 Score = 31.3 bits (71), Expect = 0.25
 Identities = 18/105 (17%), Positives = 36/105 (34%), Gaps = 2/105 (1%)

Query: 71  AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGE 130
                  + +A  + A     ++      + D+             A    +++DD+   
Sbjct: 148 KKKKKKDKKDAGKSKAKAADTSEDEDPDEDSDSEDESTDSESASATAGENEEDEDDETDS 207

Query: 131 EEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSD 175
           ++EE   +   Y   L    E   N  ++  +DEED  S +  S 
Sbjct: 208 DDEELDFS--QYDGMLASSSEDEDNDDYNEVTDEEDSESESDDSQ 250


>gnl|CDD|118020 pfam09483, HpaP, Type III secretion protein (HpaP).  This entry
           represents proteins encoded by genes which are always
           found in type III secretion operons, although their
           function in the processes of secretion and virulence is
           unclear. Hpa stands for Hrp-associated gene, where Hrp
           stands for hypersensitivity response and virulence.
          Length = 189

 Score = 30.9 bits (70), Expect = 0.30
 Identities = 24/108 (22%), Positives = 30/108 (27%), Gaps = 5/108 (4%)

Query: 11  PGGSPSAAGADREAASSPAGEPL-RKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPG 69
           P   P      R     PA   +      RDGP  E  P  P  AA    +     G  G
Sbjct: 25  PAALPDTVPPPRGDGERPADAAMPWFDETRDGPPAEADPAAPRDAASREPMARRDAGAVG 84

Query: 70  AAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLA 117
           A  AA +   +          E  A   A         +  + E  L 
Sbjct: 85  AFVAARFARTQRVVRVV----EHLAAEVAAFCAATAVRESGNWEATLP 128


>gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3.  This
           protein, which interacts with both microtubules and
           TRAF3 (tumour necrosis factor receptor-associated factor
           3), is conserved from worms to humans. The N-terminal
           region is the microtubule binding domain and is
           well-conserved; the C-terminal 100 residues, also
           well-conserved, constitute the coiled-coil region which
           binds to TRAF3. The central region of the protein is
           rich in lysine and glutamic acid and carries KKE motifs
           which may also be necessary for tubulin-binding, but
           this region is the least well-conserved.
          Length = 504

 Score = 30.6 bits (69), Expect = 0.36
 Identities = 28/128 (21%), Positives = 42/128 (32%), Gaps = 5/128 (3%)

Query: 15  PSAAGADREAASSPAGEPLRKR---PRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAA 71
           P   G DRE  +SP  EP  K+     R+ PG  +    P        V    R    + 
Sbjct: 220 PDDEGKDRETRTSPEEEPESKKSEEKSRESPGSLKKEDPPKSLETPAVVTIQVRIPTESR 279

Query: 72  AAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEE 131
            +A        A+A       +    A    +  G+        + ++   ED+DDE   
Sbjct: 280 PSARPPRPRP-ASARPAPPRVKRKQIATVLQDPQGVGELKSNV-ILESEKSEDEDDENFV 337

Query: 132 EEEAAAAA 139
            E A    
Sbjct: 338 MEAAEQDP 345


>gnl|CDD|109956 pfam00921, Lipoprotein_2, Borrelia lipoprotein.  This family of
           lipoproteins is found in Borrelia spirochetes. The
           function of these proteins is uncertain.
          Length = 173

 Score = 30.1 bits (68), Expect = 0.55
 Identities = 23/79 (29%), Positives = 29/79 (36%), Gaps = 2/79 (2%)

Query: 62  AAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLY 121
           AAA G  G A AA   +A AE +A  G    QA   + E D   G          A    
Sbjct: 34  AAAAGAAGDAEAA--AKAAAEVSAVSGADILQAIVKSKEADAQLGAGIEKAAGAAAIAFA 91

Query: 122 DEDDDDEGEEEEEAAAAAI 140
              +  E  ++     AAI
Sbjct: 92  KGGNKAELNQDAAKKDAAI 110


>gnl|CDD|114438 pfam05712, MRG, MRG.  This family consists of three different
           eukaryotic proteins (mortality factor 4 (MORF4/MRG15),
           male-specific lethal 3(MSL-3) and ESA1-associated factor
           3(EAF3)). It is thought that the MRG family is involved
           in transcriptional regulation via histone acetylation.
           It contains 2 chromo domains and a leucine zipper motif.
          Length = 260

 Score = 29.8 bits (67), Expect = 0.82
 Identities = 21/87 (24%), Positives = 34/87 (39%), Gaps = 6/87 (6%)

Query: 511 TEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDD-LDVS 569
           TE+  + Q+ELA  + L  T    S DS+SP  +S P +               D  D +
Sbjct: 16  TEENRKLQRELARAARLQKTEGSESNDSNSPTTSSKPKTK-----SLAGEDPGADSDDTT 70

Query: 570 ESKGCMEEKPQEVQTSRNVESIAEQME 596
                 + K  E   +   +  A +M+
Sbjct: 71  HVAKKKKAKKPENGRTDEEDHFAAEMK 97


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.313    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0595    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 6,592,048
Number of extensions: 652573
Number of successful extensions: 1040
Number of sequences better than  1.0: 1
Number of HSP's gapped: 952
Number of HSP's successfully gapped: 37
Length of query: 747
Length of database: 1,940,249
Length adjustment: 91
Effective length of query: 656
Effective length of database: 999,309
Effective search space: 655546704
Effective search space used: 655546704
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.1 bits)