New window

ID: GDB26118A_18677720

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB26118A_18677720
         (421 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|116144 pfam07525, SOCS_box, SOCS box.  The SOCS box acts...    55   8e-09
gnl|CDD|109458 pfam00400, WD40, WD domain, G-beta repeat.              48   1e-06
gnl|CDD|117235 pfam08662, eIF2A, Eukaryotic translation initiati...    39   7e-04
gnl|CDD|111176 pfam02254, TrkA_N, TrkA-N domain.  This domain is...    29   0.64 

>gnl|CDD|116144 pfam07525, SOCS_box, SOCS box.  The SOCS box acts as a bridge
           between specific substrate- binding domains and more
           generic proteins that comprise a large family of E3
           ubiquitin protein ligases.
          Length = 36

 Score = 55.2 bits (134), Expect = 8e-09
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 3/36 (8%)

Query: 385 PSLQHLCRMSIRRVM---PTQEVQELPIPSKLLEFL 417
            SLQHLCR++IRR +       +++LP+P +L ++L
Sbjct: 1   RSLQHLCRLAIRRSLGKDRLHAIKKLPLPPRLKDYL 36


>gnl|CDD|109458 pfam00400, WD40, WD domain, G-beta repeat. 
          Length = 39

 Score = 47.7 bits (114), Expect = 1e-06
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 249 IRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWD 284
           +R L+GH   V +  FSPDG LLA+ S D  V IWD
Sbjct: 4   LRTLKGHTGSVTSVAFSPDGNLLASGSDDGTVKIWD 39



 Score = 43.5 bits (103), Expect = 3e-05
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 204 GNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWN 242
           G +++ L+GH   V S AFSPD ++L S      V +W+
Sbjct: 1   GKLLRTLKGHTGSVTSVAFSPDGNLLASGSDDGTVKIWD 39



 Score = 43.5 bits (103), Expect = 3e-05
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 160 GKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWD 199
           GKLL  L  HT  V  + F+PDG+L L S S D T+++WD
Sbjct: 1   GKLLRTLKGHTGSVTSVAFSPDGNL-LASGSDDGTVKIWD 39



 Score = 35.0 bits (81), Expect = 0.009
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 309 ANDRWVRSVSFSHDGLHVASLADDKMVRFW 338
            +   V SV+FS DG  +AS +DD  V+ W
Sbjct: 9   GHTGSVTSVAFSPDGNLLASGSDDGTVKIW 38



 Score = 33.1 bits (76), Expect = 0.041
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 355 LCCAFSTDGSVLAAGTHDGSVYFW 378
              AFS DG++LA+G+ DG+V  W
Sbjct: 15  TSVAFSPDGNLLASGSDDGTVKIW 38


>gnl|CDD|117235 pfam08662, eIF2A, Eukaryotic translation initiation factor eIF2A.
           This is a family of eukaryotic translation initiation
           factors.
          Length = 194

 Score = 38.8 bits (91), Expect = 7e-04
 Identities = 19/88 (21%), Positives = 36/88 (40%), Gaps = 14/88 (15%)

Query: 222 FSPDSSMLCSVG---ASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATAS--- 275
           +SP   ++   G    +  +  W++     I   E    +   C++SPDG    TA+   
Sbjct: 108 WSPFGRLVLLAGFGNLAGQIEFWDVKNKKKIATAE--ASNATDCEWSPDGRYFLTATTSP 165

Query: 276 ---YDTRVYIWDPHNGDIL--MEFGHLF 298
               D    IW  ++G ++   +F  L+
Sbjct: 166 RLRVDNGFKIWH-YSGKLVYKYDFDELY 192


>gnl|CDD|111176 pfam02254, TrkA_N, TrkA-N domain.  This domain is found in a wide
           variety of proteins. These protein include potassium
           channels, phosphoesterases, and various other
           transporters. This domain binds to NAD.
          Length = 116

 Score = 29.1 bits (66), Expect = 0.64
 Identities = 11/50 (22%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 246 YTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFG 295
            ++  +L     DVV  D  P+            V + D  + ++L E G
Sbjct: 11  RSLAEELSEGGPDVVVIDKDPERVEEL-REEGVPVVVGDATDEEVLEEAG 59


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.322    0.137    0.444 

Gapped
Lambda     K      H
   0.267   0.0756    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 3,686,066
Number of extensions: 339816
Number of successful extensions: 280
Number of sequences better than  1.0: 1
Number of HSP's gapped: 278
Number of HSP's successfully gapped: 9
Length of query: 421
Length of database: 1,940,249
Length adjustment: 87
Effective length of query: 334
Effective length of database: 1,040,669
Effective search space: 347583446
Effective search space used: 347583446
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (27.6 bits)