New window

ID: GDB493911A_56606064

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB493911A_56606064
         (241 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|115538 pfam06888, Put_Phosphatase, Putative Phosphatase....   386   e-109
gnl|CDD|109746 pfam00702, Hydrolase, haloacid dehalogenase-like ...    51   8e-08

>gnl|CDD|115538 pfam06888, Put_Phosphatase, Putative Phosphatase.  This family
           contains a number of putative eukaryotic acid
           phosphatases. Some family members represent the products
           of the PSI14 phosphatase family in Lycopersicon
           esculentum (Tomato).
          Length = 234

 Score =  386 bits (993), Expect = e-109
 Identities = 118/237 (49%), Positives = 153/237 (64%), Gaps = 3/237 (1%)

Query: 3   ILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVRE 62
           IL+VFDFD TIID +SD W+V   P  +L  +LR +  KGFW E M RV K L D+GV  
Sbjct: 1   ILVVFDFDKTIIDVDSDNWVVDELPTTQLFEQLRPTMPKGFWNELMDRVMKELHDQGVSI 60

Query: 63  HEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVF 122
            ++K  + S+P  PGMV L  F+ KN    D IIISD+NS FI+ +L AA  HD+F ++F
Sbjct: 61  ADIKAVLRSIPLVPGMVRLIKFLAKNGLGCDLIIISDANSFFIETILRAAGLHDLFSEIF 120

Query: 123 TNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGN 182
           TNPA+ ++ G LTV  YH HSCN CP N+CK  VL E V  Q ++GV Y +++Y+GDG N
Sbjct: 121 TNPASVDARGRLTVLPYHDHSCNLCPSNMCKGKVLDEIVASQAREGVRYERVIYVGDGAN 180

Query: 183 DVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLI 239
           D CP   L+  DVAMPRKG+ L K +S    N   ++ SVV WSSG ++   L  LI
Sbjct: 181 DFCPSLRLRECDVAMPRKGFPLWKLISE---NPLLLKASVVEWSSGAELEEILLQLI 234


>gnl|CDD|109746 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase.  This
           family are structurally different from the alpha/ beta
           hydrolase family (pfam00561). This family includes
           L-2-haloacid dehalogenase, epoxide hydrolases and
           phosphatases. The structure of the family consists of
           two domains. One is an inserted four helix bundle, which
           is the least well conserved region of the alignment,
           between residues 16 and 96 of (S)-2-haloacid
           dehalogenase from Pseudomonas sp. CBS3. The rest of the
           fold is composed of the core alpha/beta domain.
          Length = 196

 Score = 51.1 bits (122), Expect = 8e-08
 Identities = 34/204 (16%), Positives = 62/204 (30%), Gaps = 48/204 (23%)

Query: 4   LLVFDFDNTIIDDNSD--TWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVR 61
            +VFD D T+ D        I + A    LP++      +      +  + + L + G+ 
Sbjct: 2   AVVFDKDGTLTDGEPPIAEAIEEAAAELGLPLKAPLEEVEKLLGRGLEGILRILLEGGLT 61

Query: 62  EHEMKRAVTSLPFT---------------------PGMVELFNFIRKNKDKFDCIIISDS 100
              +         T                     PG  E    +++   K    I+++ 
Sbjct: 62  AELLLELEGESAKTAVLVALDGEVLGLIALADKLYPGAREALKALKERGIKL--AILTNG 119

Query: 101 NSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEF 160
           +    + VLE     D+FD +  +                       PK     + L   
Sbjct: 120 DRANAEAVLELLGLADLFDVIVDS----------------DDVGPVKPKPEIFLLALERL 163

Query: 161 VDKQLQQGVNYTQIVYIGDGGNDV 184
                  GV   +++ +GDG ND 
Sbjct: 164 -------GVKPEEVLMVGDGVNDA 180


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.323    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0791    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 2,132,187
Number of extensions: 196256
Number of successful extensions: 182
Number of sequences better than  1.0: 1
Number of HSP's gapped: 178
Number of HSP's successfully gapped: 5
Length of query: 241
Length of database: 1,940,249
Length adjustment: 82
Effective length of query: 159
Effective length of database: 1,092,369
Effective search space: 173686671
Effective search space used: 173686671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 60 (26.8 bits)