New window

ID: GDB57524A_18079216

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB57524A_18079216
         (1431 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109587 pfam00536, SAM_1, SAM domain (Sterile alpha motif...    76   1e-14
gnl|CDD|116262 pfam07647, SAM_2, SAM domain (Sterile alpha motif...    67   1e-11
gnl|CDD|109092 pfam00023, Ank, Ankyrin repeat.  There's no clear...    56   2e-08
gnl|CDD|118302 pfam09770, PAT1, Topoisomerase II-associated prot...    49   2e-06
gnl|CDD|111991 pfam03154, Atrophin-1, Atrophin-1 family.  Atroph...    49   2e-06
gnl|CDD|117300 pfam08729, HPC2, Histone promoter control 2 (HPC2...    48   3e-06
gnl|CDD|114772 pfam06070, Herpes_UL32, Herpesvirus large structu...    48   4e-06
gnl|CDD|119187 pfam10667, DUF2486, Protein of unknown function (...    46   2e-05
gnl|CDD|116268 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src h...    44   5e-05
gnl|CDD|109087 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology ...    44   6e-05
gnl|CDD|113271 pfam04495, GRASP55_65, GRASP55/65 family.  GRASP5...    44   8e-05
gnl|CDD|113422 pfam04652, DUF605, Vta1 like.  Vta1 (VPS20-associ...    44   9e-05
gnl|CDD|118562 pfam10033, ATG13, Autophagy-related protein 13.  ...    42   2e-04
gnl|CDD|118263 pfam09731, Mitofilin, Mitochondrial inner membran...    41   4e-04
gnl|CDD|116041 pfam07420, DUF1509, Protein of unknown function (...    41   5e-04
gnl|CDD|114251 pfam05518, Totivirus_coat, Totivirus coat protein.      41   5e-04
gnl|CDD|115804 pfam07174, FAP, Fibronectin-attachment protein (F...    41   5e-04
gnl|CDD|112106 pfam03276, Gag_spuma, Spumavirus gag protein.           40   0.002
gnl|CDD|115852 pfam07223, DUF1421, Protein of unknown function (...    39   0.002
gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MI...    38   0.005
gnl|CDD|109760 pfam00716, Peptidase_S21, Assemblin (Peptidase fa...    37   0.007
gnl|CDD|113260 pfam04484, DUF566, Family of unknown function (DU...    37   0.008
gnl|CDD|114483 pfam05760, IER, Immediate early response protein ...    37   0.011
gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment...    37   0.012
gnl|CDD|111839 pfam02993, MCPVI, Minor capsid protein VI.  This ...    37   0.012
gnl|CDD|113693 pfam04929, Herpes_DNAp_acc, Herpes DNA replicatio...    36   0.020
gnl|CDD|112081 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prot...    36   0.027
gnl|CDD|113864 pfam05109, Herpes_BLLF1, Herpes virus major outer...    36   0.027
gnl|CDD|116083 pfam07462, MSP1_C, Merozoite surface protein 1 (M...    35   0.032
gnl|CDD|118259 pfam09727, CortBP2, Cortactin-binding protein-2. ...    34   0.049
gnl|CDD|115124 pfam06447, TraB_pillus, TraB pilus assembly prote...    34   0.067
gnl|CDD|111232 pfam02318, RPH3A_effector, Rabphilin-3A effector ...    34   0.086
gnl|CDD|114370 pfam05642, Sporozoite_P67, Sporozoite P67 surface...    34   0.087
gnl|CDD|115339 pfam06676, DUF1178, Protein of unknown function (...    33   0.11 
gnl|CDD|117155 pfam08580, KAR9, Yeast cortical protein KAR9.  Th...    33   0.13 
gnl|CDD|110230 pfam01213, CAP_N, Adenylate cyclase associated (C...    33   0.14 
gnl|CDD|115396 pfam06735, DUF1210, Protein of unknown function (...    33   0.14 
gnl|CDD|116036 pfam07415, Herpes_LMP2, Gammaherpesvirus latent m...    33   0.20 
gnl|CDD|115896 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32.  T...    33   0.21 
gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N terminal reg...    32   0.21 
gnl|CDD|113316 pfam04540, Herpes_UL51, Herpesvirus UL51 protein....    32   0.25 
gnl|CDD|115030 pfam06346, Drf_FH1, Formin Homology Region 1.  Th...    32   0.26 
gnl|CDD|113801 pfam05044, Prox1, Homeobox prospero-like protein ...    32   0.26 
gnl|CDD|118680 pfam10152, DUF2360, Predicted coiled-coil domain-...    32   0.26 
gnl|CDD|118949 pfam10428, SOG2, RAM signalling pathway protein. ...    32   0.34 
gnl|CDD|118379 pfam09849, DUF2076, Uncharacterized protein conse...    32   0.34 
gnl|CDD|118323 pfam09792, But2, Ubiquitin 3 binding protein But2...    31   0.40 
gnl|CDD|110072 pfam01044, Vinculin, Vinculin family.                   32   0.40 
gnl|CDD|112154 pfam03326, Herpes_TAF50, Herpesvirus transcriptio...    32   0.42 
gnl|CDD|118043 pfam09507, CDC27, DNA polymerase subunit Cdc27.  ...    31   0.44 
gnl|CDD|118020 pfam09483, HpaP, Type III secretion protein (HpaP...    31   0.44 
gnl|CDD|117962 pfam09422, WTX, WTX protein.  The WTX protein is ...    31   0.49 
gnl|CDD|114503 pfam05781, MRVI1, MRVI1 protein.  This family con...    31   0.56 
gnl|CDD|111297 pfam02389, Cornifin, Cornifin (SPRR) family.  SPR...    31   0.60 
gnl|CDD|111365 pfam02459, Adeno_terminal, Adenoviral DNA termina...    31   0.66 
gnl|CDD|114344 pfam05616, Neisseria_TspB, Neisseria meningitidis...    31   0.68 
gnl|CDD|114128 pfam05387, Chorion_3, Chorion family 3.  This fam...    31   0.74 
gnl|CDD|115307 pfam06637, PV-1, PV-1 protein (PLVAP).  This fami...    31   0.75 
gnl|CDD|115158 pfam06482, Endostatin, Collagenase NC10 and Endos...    31   0.87 
gnl|CDD|113451 pfam04683, ARM_1, Adhesion regulating molecule co...    30   0.94 

>gnl|CDD|109587 pfam00536, SAM_1, SAM domain (Sterile alpha motif).  It has been
           suggested that SAM is an evolutionarily conserved
           protein binding domain that is involved in the
           regulation of numerous developmental processes in
           diverse eukaryotes. The SAM domain can potentially
           function as a protein interaction module through its
           ability to homo- and heterooligomerise with other SAM
           domains.
          Length = 62

 Score = 76.5 bits (189), Expect = 1e-14
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 473 SSEAVSQWLTAFQLQLYAPNFISAGY-DLPTISRMTPEDLTAIGVTKPGHRKKIAAEISG 531
           S E V +WL +  L  YA NF  AGY D   +  +T EDL  +GVT  GHRKKI + I G
Sbjct: 2   SVEDVGEWLESIGLGQYADNF-RAGYIDGDALLLLTEEDLKKLGVTLLGHRKKILSSIQG 60

Query: 532 L 532
           L
Sbjct: 61  L 61



 Score = 69.6 bits (171), Expect = 1e-12
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 549 WLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKL 602
           WL  IGL QY       GY + D +  +T EDL+++G+T LGH+KK++ +++ L
Sbjct: 9   WLESIGLGQYADNFR-AGYIDGDALLLLTEEDLKKLGVTLLGHRKKILSSIQGL 61


>gnl|CDD|116262 pfam07647, SAM_2, SAM domain (Sterile alpha motif). 
          Length = 68

 Score = 66.9 bits (164), Expect = 1e-11
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 470 EGKSSEAVSQWLTAFQLQLYAPNFISAGYD-LPTISRMTPEDLTAIGVTKPGHRKKIAAE 528
           E  S E V++WL +  L  YA NF   G      + R+T EDL A+G+T  GHR+KI  +
Sbjct: 2   ESWSLEDVAEWLRSIGLPQYADNFRDQGITGGELLLRLTEEDLKALGITSVGHRRKILKK 61

Query: 529 I 529
           I
Sbjct: 62  I 62



 Score = 63.1 bits (154), Expect = 1e-10
 Identities = 21/65 (32%), Positives = 37/65 (56%)

Query: 538 LPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLML 597
           +      ++A WL  IGL QY     D G    + +  +T EDL+ +GIT +GH++K++ 
Sbjct: 1   VESWSLEDVAEWLRSIGLPQYADNFRDQGITGGELLLRLTEEDLKALGITSVGHRRKILK 60

Query: 598 AVRKL 602
            +++L
Sbjct: 61  KIQRL 65


>gnl|CDD|109092 pfam00023, Ank, Ankyrin repeat.  There's no clear separation
           between noise and signal on the HMM search Ankyrin
           repeats generally consist of a beta, alpha, alpha, beta
           order of secondary structures. The repeats associate to
           form a higher order structure.
          Length = 33

 Score = 55.7 bits (135), Expect = 2e-08
 Identities = 18/33 (54%), Positives = 29/33 (87%)

Query: 188 NGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTK 220
           +G +PLHLAA+NGH+++++LLL+AG D+N + K
Sbjct: 1   DGNTPLHLAARNGHLEVVKLLLEAGADVNARDK 33



 Score = 47.2 bits (113), Expect = 8e-06
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 48 DGFSALHHAALNGNTELISLLLEAQAAVDIKDN 80
          DG + LH AA NG+ E++ LLLEA A V+ +D 
Sbjct: 1  DGNTPLHLAARNGHLEVVKLLLEAGADVNARDK 33



 Score = 46.0 bits (110), Expect = 2e-05
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 114 EGHIPLHLAAQHGHYDVSEMLLQHQSNPCMVDN 146
           +G+ PLHLAA++GH +V ++LL+  ++    D 
Sbjct: 1   DGNTPLHLAARNGHLEVVKLLLEAGADVNARDK 33



 Score = 42.6 bits (101), Expect = 2e-04
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 223 TALHEAALCGKTEVVRLLLDSGINAHVRN 251
           T LH AA  G  EVV+LLL++G + + R+
Sbjct: 4   TPLHLAARNGHLEVVKLLLEAGADVNARD 32



 Score = 34.1 bits (79), Expect = 0.071
 Identities = 12/22 (54%), Positives = 14/22 (63%)

Query: 148 GKTPLDLACEFGRVGVVQLLLS 169
           G TPL LA   G + VV+LLL 
Sbjct: 2   GNTPLHLAARNGHLEVVKLLLE 23



 Score = 33.7 bits (78), Expect = 0.083
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 81  KGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSD 113
            G  PLH AA  G  E +KL+L+AG+ VN    
Sbjct: 1   DGNTPLHLAARNGHLEVVKLLLEAGADVNARDK 33


>gnl|CDD|118302 pfam09770, PAT1, Topoisomerase II-associated protein PAT1.  Members
            of this family are necessary for accurate chromosome
            transmission during cell division.
          Length = 792

 Score = 49.4 bits (118), Expect = 2e-06
 Identities = 39/197 (19%), Positives = 60/197 (30%), Gaps = 7/197 (3%)

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQ 1240
             A +   P + P   P    P   +  L  +     + ++  + P  P+ VL Q +P  Q
Sbjct: 128  TAPKPPQPAQAPESQPQPAAPAKKMLSLEEVEAQLQQRQQAPQLPQPPQQVLPQGMPPRQ 187

Query: 1241 GSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPV--KAVAGLPSGSAGPS 1298
             +        P   PG P+ ++    PP    + P PP  P+          P  S    
Sbjct: 188  AAFPQQQP--PEQPPGFPQPQQFQPHPPQQPAQRPLPPQLPQQPPPLQQPQFPGLSQQMP 245

Query: 1299 PAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPA 1358
            P P    Q      +P   PP         P P  P     + PP            P  
Sbjct: 246  PPPPQPPQQQQQPPQPQAQPP---PQNPPTPHPQLPQGQNASLPPPQQPQLLPLVQQPQP 302

Query: 1359 PPEGASPGDSARQKLEE 1375
               G    +   Q  ++
Sbjct: 303  QQRGPQFREQLVQLSQQ 319



 Score = 46.7 bits (111), Expect = 1e-05
 Identities = 28/157 (17%), Positives = 35/157 (22%), Gaps = 8/157 (5%)

Query: 1179 RRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPK 1238
            ++       P       P   PP    A  P   PPE     P      P P        
Sbjct: 163  QQRQQAPQLPQPPQQVLPQGMPPRQ--AAFPQQQPPEQPPGFPQPQQFQPHPPQQPAQRP 220

Query: 1239 LQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPS 1298
            L           P P         +   PPP  P  PP      P       P     P 
Sbjct: 221  LPPQLPQ----QPPPLQQPQFPGLSQQMPPP--PPQPPQQQQQPPQPQAQPPPQNPPTPH 274

Query: 1299 PAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPA 1335
            P     +       + P   P +     +   P    
Sbjct: 275  PQLPQGQNASLPPPQQPQLLPLVQQPQPQQRGPQFRE 311



 Score = 41.3 bits (97), Expect = 5e-04
 Identities = 39/230 (16%), Positives = 50/230 (21%), Gaps = 27/230 (11%)

Query: 1157 REAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEG 1216
               G     P S       T   R   E +  PE   P   A+P     A  PP P    
Sbjct: 81   NAPGAPSVSPDSDLSQKFSTSPCRTGYEASTDPE-YIPDLQADPSLWGTAPKPPQPAQ-- 137

Query: 1217 EARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPP 1276
                 A           + +  L+       ++   P    P        P  V P+  P
Sbjct: 138  -----APESQPQPAAPAKKMLSLEEVEAQLQQRQQAPQLPQP--------PQQVLPQGMP 184

Query: 1277 PPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPAL 1336
            P  A  P +     P G   P         PP   A+ P         P + P    P  
Sbjct: 185  PRQAAFPQQQPPEQPPGFPQPQQFQ---PHPPQQPAQRP--------LPPQLPQQPPPLQ 233

Query: 1337 HVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLAAALQA 1386
                                              Q        L     A
Sbjct: 234  QPQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNPPTPHPQLPQGQNA 283



 Score = 39.7 bits (93), Expect = 0.001
 Identities = 37/214 (17%), Positives = 57/214 (26%), Gaps = 13/214 (6%)

Query: 678 PSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGT 737
             +   P      + D SL G A       +     P     P + +++ L  E      
Sbjct: 107 YEASTDPEYIPDLQADPSLWGTAPKPPQPAQA----PESQPQPAAPAKKMLSLEEVEAQL 162

Query: 738 PPREARPG---RHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGS------P 788
             R+  P         + +   P     P+Q  P     F  PQ      P        P
Sbjct: 163 QQRQQAPQLPQPPQQVLPQGMPPRQAAFPQQQPPEQPPGFPQPQQFQPHPPQQPAQRPLP 222

Query: 789 QALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPAA 848
             L     P         + Q+ PP  +P   +  P  P  +      P P         
Sbjct: 223 PQLPQQPPPLQQPQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNPPTPHPQLPQGQN 282

Query: 849 PGPAPPPVPTAVPTLCLPPEADAEPGRPKKRAHS 882
               PP  P  +P +  P      P   ++    
Sbjct: 283 ASLPPPQQPQLLPLVQQPQPQQRGPQFREQLVQL 316



 Score = 38.6 bits (90), Expect = 0.003
 Identities = 27/147 (18%), Positives = 31/147 (21%), Gaps = 6/147 (4%)

Query: 1217 EARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPP 1276
                P  P VSP   L+Q         T              +       P      P P
Sbjct: 79   NQNAPGAPSVSPDSDLSQK-FSTSPCRTGYEASTDPEYIPDLQAD-----PSLWGTAPKP 132

Query: 1277 PPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPAL 1336
            P  A  P              S     A+      A     PP        PP   A   
Sbjct: 133  PQPAQAPESQPQPAAPAKKMLSLEEVEAQLQQRQQAPQLPQPPQQVLPQGMPPRQAAFPQ 192

Query: 1337 HVPAKPPRAAAAAAAAAAAPPAPPEGA 1363
              P + P            PP  P   
Sbjct: 193  QQPPEQPPGFPQPQQFQPHPPQQPAQR 219



 Score = 35.5 bits (82), Expect = 0.024
 Identities = 42/209 (20%), Positives = 62/209 (29%), Gaps = 16/209 (7%)

Query: 633 SPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRATTRQ 692
           +P PP+P  A    P+        LS E   A     +  P   +P   + P        
Sbjct: 129 APKPPQPAQAPESQPQPAAPAKKMLSLEEVEAQLQQRQQAPQLPQPPQQVLPQG------ 182

Query: 693 DSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHS-- 750
                 +A            G P P        +    + P P   P++  P +      
Sbjct: 183 --MPPRQAAFPQQQPPEQPPGFPQPQQFQPHPPQQPA-QRPLPPQLPQQPPPLQQPQFPG 239

Query: 751 IKRASVPPVPGKP-RQVLPPGTSHFTPPQTPTKTRPGSPQALGGPHGPAPATAKVKPTPQ 809
           + +   PP P  P +Q  PP      PPQ P    P  PQ       P P   ++ P  Q
Sbjct: 240 LSQQMPPPPPQPPQQQQQPPQPQAQPPPQNPPTPHPQLPQGQNASL-PPPQQPQLLPLVQ 298

Query: 810 LLPPTERPMSPRSLPQSPTHRGFAYVLPQ 838
              P +R    R   +        +    
Sbjct: 299 QPQPQQRGPQFR---EQLVQLSQQHREAL 324


>gnl|CDD|111991 pfam03154, Atrophin-1, Atrophin-1 family.  Atrophin-1 is the protein
            product of the dentatorubral-pallidoluysian atrophy
            (DRPLA) gene. DRPLA OMIM:125370 is a progressive
            neurodegenerative disorder. It is caused by the expansion
            of a CAG repeat in the DRPLA gene on chromosome 12p. This
            results in an extended polyglutamine region in
            atrophin-1, that is thought to confer toxicity to the
            protein, possibly through altering its interactions with
            other proteins. The expansion of a CAG repeat is also the
            underlying defect in six other neurodegenerative
            disorders, including Huntington's disease. One
            interaction of expanded polyglutamine repeats that is
            thought to be pathogenic is that with the short glutamine
            repeat in the transcriptional coactivator CREB binding
            protein, CBP. This interaction draws CBP away from its
            usual nuclear location to the expanded polyglutamine
            repeat protein aggregates that are characteristic of the
            polyglutamine neurodegenerative disorders. This
            interferes with CBP-mediated transcription and causes
            cytotoxicity.
          Length = 984

 Score = 49.4 bits (117), Expect = 2e-06
 Identities = 37/168 (22%), Positives = 49/168 (29%)

Query: 1193 PPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPL 1252
            PPPP A    T  +   P   P+G    PA    S  P  +   P       P ++ VP 
Sbjct: 171  PPPPAAALAETPASSSAPPGTPQGPTIAPAPSAPSAPPQQSPTAPPPDVPQQPGAQSVPA 230

Query: 1253 PGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALA 1312
              P        H   PP    P  P   P  + +              PSP       L 
Sbjct: 231  VAPSIQAASALHPQRPPSPHNPLSPFLFPPSLPSAQPHAQPPLHGQGPPSPHSLQAGPLL 290

Query: 1313 KPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPP 1360
            + P  P +     A             A P ++A  +       P PP
Sbjct: 291  QHPQPPQNFLPPQASQGQAPLGTSPAAAYPSQSALQSQQPPREQPLPP 338



 Score = 46.7 bits (110), Expect = 1e-05
 Identities = 48/212 (22%), Positives = 69/212 (32%), Gaps = 17/212 (8%)

Query: 1161 PEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDL-AHLPPLPPPEGEAR 1219
            P PP P  + H         P  +   P     PP  + P P  + ++LPP P  +  + 
Sbjct: 335  PLPPAPSGMPH--IKPPPTTPIPQLPAPQSHKHPPHLSSPTPFQMPSNLPPPPALKPLSS 392

Query: 1220 KPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPT 1279
             P   P S  P   Q +P+ Q  P  T++         P + ++   P PV+  P     
Sbjct: 393  LPTHHPPSAHPPPLQLMPQSQPLPASTAQ--------PPHLTQSQNLPSPVASHPGKGTH 444

Query: 1280 APKPVKAVAGLPSGSAGPSPAPSPARQP--PAALAKPPGTPPSLGASPAKPPSPGAPALH 1337
                    A  P      S    P+  P            PP  GA+ +    P A +  
Sbjct: 445  QHASAPPFASHPLTPVTHSAIGPPSLPPTSTFPAPGTSAQPPCSGAAASGGSPPRASSGS 504

Query: 1338 VPAKPP----RAAAAAAAAAAAPPAPPEGASP 1365
                P           A    +PP PP   SP
Sbjct: 505  TAELPQIQIKEEPLDEAEEPESPPPPPRSPSP 536



 Score = 46.0 bits (108), Expect = 2e-05
 Identities = 52/231 (22%), Positives = 71/231 (30%), Gaps = 14/231 (6%)

Query: 1151 RPKAKEREAGPEPPPPLSVYHNGTGTVRRRP---ASEQAGPPELPPPPPPAEPPPTDLAH 1207
            +P A+    G  PP P S+         + P      QA   + P    PA   P+  A 
Sbjct: 266  QPHAQPPLHGQGPPSPHSLQAGPLLQHPQPPQNFLPPQASQGQAPLGTSPAAAYPSQSAL 325

Query: 1208 LPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPT---------PTSKKVPLPGPGSP 1258
                PP E             KP  T P+P+L    +         PT  ++P   P  P
Sbjct: 326  QSQQPPREQPLPPAPSGMPHIKPPPTTPIPQLPAPQSHKHPPHLSSPTPFQMPSNLPPPP 385

Query: 1259 EVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTP 1318
             +K     P    P   PPP    P      LP+ +A P         P    + P    
Sbjct: 386  ALKPLSSLPTHHPPSAHPPPLQLMP--QSQPLPASTAQPPHLTQSQNLPSPVASHPGKGT 443

Query: 1319 PSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSA 1369
                ++P     P  P  H    PP     +   A    A P  +    S 
Sbjct: 444  HQHASAPPFASHPLTPVTHSAIGPPSLPPTSTFPAPGTSAQPPCSGAAASG 494



 Score = 38.3 bits (88), Expect = 0.004
 Identities = 43/199 (21%), Positives = 64/199 (32%), Gaps = 4/199 (2%)

Query: 1161 PEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARK 1220
                PP +            P++     P  PPP  P +P    +  + P       A  
Sbjct: 184  SSSAPPGTPQGPTIAPAPSAPSAPPQQSPTAPPPDVPQQPGAQSVPAVAPS-IQAASALH 242

Query: 1221 PAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTA 1280
            P +PP    P+     P    S  P ++  PL G G P        P    P+PP     
Sbjct: 243  PQRPPSPHNPLSPFLFPPSLPSAQPHAQP-PLHGQGPPSPHSLQAGPLLQHPQPPQNFLP 301

Query: 1281 PKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPA 1340
            P+  +  A L +  A   P+ S  +       +P   PP+    P   P P  P   +PA
Sbjct: 302  PQASQGQAPLGTSPAAAYPSQSALQSQQPPREQP--LPPAPSGMPHIKPPPTTPIPQLPA 359

Query: 1341 KPPRAAAAAAAAAAAPPAP 1359
                      ++      P
Sbjct: 360  PQSHKHPPHLSSPTPFQMP 378



 Score = 37.1 bits (85), Expect = 0.009
 Identities = 35/171 (20%), Positives = 51/171 (29%), Gaps = 6/171 (3%)

Query: 1233 TQPVPKLQGSP-TPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLP 1291
            +QP P       TP S   P   P  P +      P P +P  PP  +   P   V   P
Sbjct: 169  SQPPPPAAALAETPASSSAPPGTPQGPTI-----APAPSAPSAPPQQSPTAPPPDVPQQP 223

Query: 1292 SGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAA 1351
               + P+ APS          +PP     L      P  P A     P    +   +  +
Sbjct: 224  GAQSVPAVAPSIQAASALHPQRPPSPHNPLSPFLFPPSLPSAQPHAQPPLHGQGPPSPHS 283

Query: 1352 AAAAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQEDAQGPRDS 1402
              A P              Q  +  +    +   A   +   +  Q PR+ 
Sbjct: 284  LQAGPLLQHPQPPQNFLPPQASQGQAPLGTSPAAAYPSQSALQSQQPPREQ 334



 Score = 37.1 bits (85), Expect = 0.010
 Identities = 28/131 (21%), Positives = 39/131 (29%), Gaps = 1/131 (0%)

Query: 1235 PVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGS 1294
            P P+   S + +S +        P    A    P  S  PP  P  P    A +  PS  
Sbjct: 149  PSPQDNESDSDSSAQQQGLQSQPPPPAAALAETPASSSAPPGTPQGPTIAPAPSA-PSAP 207

Query: 1295 AGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAA 1354
               SP   P   P    A+          + +       P+ H P  P     +  +A  
Sbjct: 208  PQQSPTAPPPDVPQQPGAQSVPAVAPSIQAASALHPQRPPSPHNPLSPFLFPPSLPSAQP 267

Query: 1355 APPAPPEGASP 1365
                P  G  P
Sbjct: 268  HAQPPLHGQGP 278



 Score = 33.2 bits (75), Expect = 0.14
 Identities = 30/128 (23%), Positives = 38/128 (29%), Gaps = 14/128 (10%)

Query: 1165 PPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKP 1224
            P     H G GT +   A   A  P  P       PP        P P         A+P
Sbjct: 432  PSPVASHPGKGTHQHASAPPFASHPLTPVTHSAIGPPSLPPTSTFPAPGTS------AQP 485

Query: 1225 PVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPV 1284
            P S         P+     T    ++ +      E +            PPPPP +P P 
Sbjct: 486  PCSGAAASGGSPPRASSGSTAELPQIQIKEEPLDEAEEPE--------SPPPPPRSPSPE 537

Query: 1285 KAVAGLPS 1292
              V   PS
Sbjct: 538  PTVVNTPS 545



 Score = 31.7 bits (71), Expect = 0.35
 Identities = 88/422 (20%), Positives = 120/422 (28%), Gaps = 33/422 (7%)

Query: 633  SPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRATTRQ 692
            S  P  P+P D +S   ++ Q   L    Q+    PA     T   SS  P TP+  T  
Sbjct: 143  SSSPSIPSPQDNESDSDSSAQQQGL----QSQPPPPAAALAETPASSSAPPGTPQGPTIA 198

Query: 693  DSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPA-----PGTPPREARPGRH 747
             +     A    S      D P  P +    +    +    A     P +P     P   
Sbjct: 199  PAPSAPSAPPQQSPTAPPPDVPQQPGAQSVPAVAPSIQAASALHPQRPPSPHNPLSPFLF 258

Query: 748  GHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGSPQALGGPHGPAPATAKVKPT 807
              S+  A     P    Q  P   S    P       P +        G AP        
Sbjct: 259  PPSLPSAQPHAQPPLHGQGPPSPHSLQAGPLLQHPQPPQNFLPPQASQGQAPLGTSPAAA 318

Query: 808  PQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPAAPGPAPPPVPTAVPTLC--- 864
                   +    PR  P  P   G  ++ P P        AP     P   + PT     
Sbjct: 319  YPSQSALQSQQPPREQPLPPAPSGMPHIKPPPTTPIPQLPAPQSHKHPPHLSSPTPFQMP 378

Query: 865  --LPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLVPAAAGPYATVQRRVGRSHSVRA 922
              LPP    +P       H  + +        + + L  + A P    Q +   S     
Sbjct: 379  SNLPPPPALKPLSSLPTHHPPSAHPPPLQLMPQSQPLPASTAQPPHLTQSQNLPSPVASH 438

Query: 923  PAGADKNVNRSQSFAVRPRKKGPPPP--PPKRSSSALASANLADEPVPDAEPEDGLLGVR 980
            P         +  FA  P          PP    ++   A     P   A+P        
Sbjct: 439  PGKGTHQHASAPPFASHPLTPVTHSAIGPPSLPPTSTFPA-----PGTSAQPP------- 486

Query: 981  AQCRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPRPASPEPGRV 1040
              C  A+   GS    S+GS   +  +               PP   P PR  SPEP  V
Sbjct: 487  --CSGAAASGGSPPRASSGSTAELPQIQIKEEPLDEAEEPESPP---PPPRSPSPEPTVV 541

Query: 1041 AT 1042
             T
Sbjct: 542  NT 543


>gnl|CDD|117300 pfam08729, HPC2, Histone promoter control 2 (HPC2).  HPC2 is required
            for cell-cycle regulation of histone transcription. It
            regulates transcription of the histone genes during the
            S-phase of the cell cycle by repressing transcription at
            other cell cycle stages. HPC2 mutants display synthetic
            interactions with FACT complex which allows RNA Pol II to
            elongate through nucleosomes.
          Length = 502

 Score = 48.4 bits (115), Expect = 3e-06
 Identities = 49/230 (21%), Positives = 68/230 (29%), Gaps = 17/230 (7%)

Query: 1161 PEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARK 1220
                 PL+  ++ + T      S       L          P   +  PPLP P      
Sbjct: 15   QRAKSPLTNSNSSSNTPHPSSQSSPIPLSSLVSNQTNPRKKPKISSPTPPLPQP-----S 69

Query: 1221 PAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVS---PKPPPP 1277
            P        PV     P      T            +P  +  H     ++    K    
Sbjct: 70   PTPLQKQQSPVSQLLSPPQAQQQTSQQLGPLNSKAITPPSRALHAPSTAIAINQHKGSSN 129

Query: 1278 PTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPS-----LGASPAKP-PSP 1331
             T+P+     A  P  S   S AP+P     ++   PP   P        ASPA P  + 
Sbjct: 130  ATSPQKPSGQAYDPIRSEPASAAPAPPSSTASSPGSPPTPAPKPRPFRASASPATPTTTQ 189

Query: 1332 GAPALHVPAKPPRAAAAAAAAAAAPP---APPEGASPGDSARQKLEETSA 1378
                     KP + A+ A  A  +P    AP    SP   A  K  +  A
Sbjct: 190  AITKPASEKKPSKPASTAGLANKSPTPTKAPLSHKSPKSPAAPKKADKKA 239



 Score = 34.2 bits (78), Expect = 0.069
 Identities = 38/237 (16%), Positives = 61/237 (25%), Gaps = 8/237 (3%)

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPV--SPKPVLTQPVPK 1238
            P + +A  P       P+     +            +    A  P+   P      P   
Sbjct: 99   PLNSKAITPPSRALHAPSTAIAINQHKGSSNATSPQKPSGQAYDPIRSEPASAAPAPPSS 158

Query: 1239 LQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPS 1298
               SP       P P P       A  T      KP       KP  + AGL + S  P+
Sbjct: 159  TASSPGSPPTPAPKPRPFRASASPATPTTTQAITKPASEKKPSKP-ASTAGLANKSPTPT 217

Query: 1299 PAPSPARQPPAALAKPPGTPPSLGASPAKPPS-----PGAPALHVPAKPPRAAAAAAAAA 1353
             AP   + P +  A       +     +  PS             P+ PP +   +    
Sbjct: 218  KAPLSHKSPKSPAAPKKADKKASKDVKSVKPSDSNVPASTKPNSEPSPPPPSVIQSLTKK 277

Query: 1354 AAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQEDAQGPRDSAAEKSTGS 1410
            ++ P+   G         K                   ++     P+ +   K    
Sbjct: 278  SSSPSTSVGIDKDSGEGSKPAAEKKKEKKEAGETTNTAKKPKPPSPKPARPAKEAPE 334



 Score = 33.8 bits (77), Expect = 0.084
 Identities = 44/189 (23%), Positives = 56/189 (29%), Gaps = 8/189 (4%)

Query: 1158 EAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGE 1217
            E     P P S   +  G+        +       P  P      T  A       P   
Sbjct: 147  EPASAAPAPPSSTASSPGSPPTPAPKPRPFRASASPATPTTTQAITKPASEKKPSKPAST 206

Query: 1218 ARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSP----K 1273
            A    K P   K  L+   PK   SP    K           VK +    P  +      
Sbjct: 207  AGLANKSPTPTKAPLSHKSPK---SPAAPKKADKKASKDVKSVKPSDSNVPASTKPNSEP 263

Query: 1274 PPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGA 1333
             PPPP+  + +   +  PS S G     S     PAA  K          + AK P P +
Sbjct: 264  SPPPPSVIQSLTKKSSSPSTSVGID-KDSGEGSKPAAEKKKEKKEAGETTNTAKKPKPPS 322

Query: 1334 PALHVPAKP 1342
            P    PAK 
Sbjct: 323  PKPARPAKE 331



 Score = 30.7 bits (69), Expect = 0.79
 Identities = 48/302 (15%), Positives = 81/302 (26%), Gaps = 23/302 (7%)

Query: 673 PTTEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEG 732
                      P   + +  ++              L+ +       P   S    L + 
Sbjct: 9   NRNSVRQRAKSPLTNSNSSSNTPHPSSQSSPIPLSSLVSNQTNPRKKPKISSPTPPLPQ- 67

Query: 733 PAPGTPPREARPGRHGHSIKRASVPPVPGKPR-QVLPPGTSHFTPPQTPTKTRPGSPQAL 791
           P+P    ++  P     S      PP   +   Q L P  S    P +     P +  A+
Sbjct: 68  PSPTPLQKQQSPVSQLLS------PPQAQQQTSQQLGPLNSKAITPPSRALHAPSTAIAI 121

Query: 792 GGPHGPAPATAKVKPTPQLLPPTERP--MSPRSLPQSPTHRGFAYVLPQPVEGEVGPAAP 849
               G + AT+  KP+ Q   P       +  + P S      +   P P       A+ 
Sbjct: 122 NQHKGSSNATSPQKPSGQAYDPIRSEPASAAPAPPSSTASSPGSPPTPAPKP-RPFRASA 180

Query: 850 GPAPPPVPTAVPTLCLPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLVPAAAGPYAT 909
            PA P    A+       +             S     A  S         P  A     
Sbjct: 181 SPATPTTTQAITKPASEKKPSKPASTAGLANKSPTPTKAPLSHKSPKSPAAPKKADK--- 237

Query: 910 VQRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASANLADEPVPD 969
                           + K  + +   + +P  +  PPPP    S    S++ +     D
Sbjct: 238 ---------KASKDVKSVKPSDSNVPASTKPNSEPSPPPPSVIQSLTKKSSSPSTSVGID 288

Query: 970 AE 971
            +
Sbjct: 289 KD 290


>gnl|CDD|114772 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein
            UL32.  The large phosphorylated protein (UL32-like) of
            herpes viruses is the polypeptide most frequently
            reactive in immuno-blotting analyses with antisera when
            compared with other viral proteins.
          Length = 807

 Score = 48.4 bits (115), Expect = 4e-06
 Identities = 34/165 (20%), Positives = 49/165 (29%), Gaps = 7/165 (4%)

Query: 1213 PPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSP 1272
            P E +A  P +  VS  PV+   V +  GSP+       LP      +        P+S 
Sbjct: 630  PVETQAPGPRRSLVSDSPVVGLLVKQDAGSPSGGPSTKLLPQFTGTIILTEDVIKDPLST 689

Query: 1273 KPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQP----PAALAKPPGTPPSLGASPAKP 1328
                  +   P K   G    +       SP R P     AA  +   +     A   K 
Sbjct: 690  PDKTYKSPSTPRKPGPGGRENNLKNERDLSPLRSPFSLPSAARPRKASSARGSPAGSLKS 749

Query: 1329 PSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKL 1373
               G   +      P    +  A          GA  GD   + +
Sbjct: 750  TLTGKAVV---GTAPGWDKSGEAGDRVLGDDEGGAKEGDDIVETI 791


>gnl|CDD|119187 pfam10667, DUF2486, Protein of unknown function (DUF2486).  This
            family is made up of members from various Burkholderia
            spp. The function is unknown.
          Length = 245

 Score = 45.7 bits (108), Expect = 2e-05
 Identities = 41/168 (24%), Positives = 54/168 (32%), Gaps = 5/168 (2%)

Query: 1193 PPPPPAEPPPTD-LAHLPPLPPPEGEARKPAKPPVSPKPVLT-QPVPKLQGSPTPTSKKV 1250
                 + P  TD L    P+P     A        + +PVLT Q VP  + + +      
Sbjct: 3    QANDSSIPTLTDVLVPGHPVPARSSSADAAGPHDDAAEPVLTDQIVPGAEQAASAAPVHA 62

Query: 1251 PLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAA 1310
                   PE       P P  P    P     P +  A   +       A +     P+A
Sbjct: 63   AREATADPEFVAVEPVPTPHVPAVALPGDTDAPAEPGA---APHVVAERAAAMQAPLPSA 119

Query: 1311 LAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPA 1358
            LA      P  GA+ A        A    A      AAA AAA+A  A
Sbjct: 120  LAADDPQAPPAGATAADAGDAAPDATPPAAGDASPPAAAQAAASAAAA 167



 Score = 33.7 bits (77), Expect = 0.099
 Identities = 32/159 (20%), Positives = 48/159 (30%), Gaps = 18/159 (11%)

Query: 1252 LPGPGSPEVKRAHGTP--PPVSPKPPPPPTAPKPVKAVAGLPSGSAGP---SPAPSPARQ 1306
                 S +    H     P ++ +  P          V      +A P   +  P P   
Sbjct: 23   PARSSSADAAGPHDDAAEPVLTDQIVPGAEQAASAAPVHAAREATADPEFVAVEPVPTPH 82

Query: 1307 PPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAA-------AAAAAAAAAPPAP 1359
             PA         P+   +     +  A A+  P     AA       A A AA A   AP
Sbjct: 83   VPAVALPGDTDAPAEPGAAPHVVAERAAAMQAPLPSALAADDPQAPPAGATAADAGDAAP 142

Query: 1360 P------EGASPGDSARQKLEETSACLAAALQAVEEKIR 1392
                     ASP  +A+      +A      Q + E++R
Sbjct: 143  DATPPAAGDASPPAAAQAAASAAAALTDLDAQHIAERLR 181


>gnl|CDD|116268 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src homology 3) domains
           are often indicative of a protein involved in signal
           transduction related to cytoskeletal organisation. First
           described in the Src cytoplasmic tyrosine kinase. The
           structure is a partly opened beta barrel.
          Length = 53

 Score = 44.4 bits (106), Expect = 5e-05
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 286 VRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSS 340
            R   DY    D   L +K GD++ VL++  DG W+G       G  R G  PSS
Sbjct: 2   GRVIFDY-VATDKNELTLKKGDVVKVLDKDDDGWWEG-----ERGG-RRGLVPSS 49


>gnl|CDD|109087 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology 3) domains are
           often indicative of a protein involved in signal
           transduction related to cytoskeletal organisation. First
           described in the Src cytoplasmic tyrosine kinase. The
           structure is a partly opened beta barrel.
          Length = 56

 Score = 44.1 bits (105), Expect = 6e-05
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 6/56 (10%)

Query: 285 QVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSS 340
           +V A  DY        L+ K GDII VLE+  DG WKG +          G  PS+
Sbjct: 2   KVVALYDYEAREP-DELSFKKGDIIIVLEKSDDGWWKGRLKGGGE-----GLVPSN 51


>gnl|CDD|113271 pfam04495, GRASP55_65, GRASP55/65 family.  GRASP55 (Golgi reassembly
            stacking protein of 55 kDa) and GRASP65 (a 65 kDa)
            protein are highly homologous. GRASP55 is a component of
            the Golgi stacking machinery. GRASP65, an
            N-ethylmaleimide- sensitive membrane protein required for
            the stacking of Golgi cisternae in a cell-free system.
          Length = 321

 Score = 43.8 bits (103), Expect = 8e-05
 Identities = 37/171 (21%), Positives = 47/171 (27%), Gaps = 5/171 (2%)

Query: 1162 EPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKP 1221
            +P  PLSV             S    P   PP P             PP    +G    P
Sbjct: 141  QPKVPLSVTPPSPAATNFPDPSPLLSPFSAPPAPSSVLQLGGPTPPYPPPLVQQGSYAPP 200

Query: 1222 AKPPV---SPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPP 1278
             +P      P  +L   +     + +      P P P  P V+     PPP       P 
Sbjct: 201  VEPETQLPPPSSLLGHGLSSSANAGSSNEIPPPAPQPTPPYVQSPSAQPPPPPYNQQRPG 260

Query: 1279 TAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPP 1329
               K    +    S SA     P       A  A    +      SP  PP
Sbjct: 261  KLDKS--GIQPPTSLSALDPEEPLSPELTAATTAVSSSSDSQTTYSPPSPP 309



 Score = 39.9 bits (93), Expect = 0.001
 Identities = 41/196 (20%), Positives = 51/196 (26%), Gaps = 25/196 (12%)

Query: 1180 RPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKL 1239
            +P+ +   P  + PP P A   P     L P   P      PA   V      T P P  
Sbjct: 137  QPSIQPKVPLSVTPPSPAATNFPDPSPLLSPFSAP------PAPSSVLQLGGPTPPYPP- 189

Query: 1240 QGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSP 1299
                       PL   GS         P    P P           A AG  +    P+P
Sbjct: 190  -----------PLVQQGS---YAPPVEPETQLPPPSSLLGHGLSSSANAGSSNEIPPPAP 235

Query: 1300 APSPARQPPAALAKPPGT----PPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAA 1355
             P+P      +   PP       P         P     AL           AA  A ++
Sbjct: 236  QPTPPYVQSPSAQPPPPPYNQQRPGKLDKSGIQPPTSLSALDPEEPLSPELTAATTAVSS 295

Query: 1356 PPAPPEGASPGDSARQ 1371
                    SP      
Sbjct: 296  SSDSQTTYSPPSPPVS 311



 Score = 31.1 bits (70), Expect = 0.56
 Identities = 47/210 (22%), Positives = 64/210 (30%), Gaps = 36/210 (17%)

Query: 668 PAEVGPTTEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEY 727
           P +     + P S  PP+P AT   D S                  PP PSS +      
Sbjct: 135 PTQPSIQPKVPLSVTPPSPAATNFPDPSPLLSP----------FSAPPAPSSVLQLG--- 181

Query: 728 LLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGS 787
               GP P  PP   + G        +  PPV  +P   LPP +S      + +     S
Sbjct: 182 ----GPTPPYPPPLVQQG--------SYAPPV--EPETQLPPPSSLLGHGLSSSANAG-S 226

Query: 788 PQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPA 847
              +  P           P+ Q  PP      P  L +S        + P      + P 
Sbjct: 227 SNEIPPPAPQPTPPYVQSPSAQPPPPPYNQQRPGKLDKSG-------IQPPTSLSALDPE 279

Query: 848 APG-PAPPPVPTAVPTLCLPPEADAEPGRP 876
            P  P      TAV +        + P  P
Sbjct: 280 EPLSPELTAATTAVSSSSDSQTTYSPPSPP 309


>gnl|CDD|113422 pfam04652, DUF605, Vta1 like.  Vta1 (VPS20-associated protein 1) is a
            positive regulator of Vps4. Vps4 is an ATPase that is
            required in the multivesicular body (MVB) sorting pathway
            to dissociate the endosomal sorting complex required for
            transport (ESCRT). Vta1 promotes correct assembly of Vps4
            and stimulates its ATPase activity through its conserved
            Vta1/SBP1/LIP5 region.
          Length = 335

 Score = 43.6 bits (103), Expect = 9e-05
 Identities = 30/162 (18%), Positives = 48/162 (29%), Gaps = 4/162 (2%)

Query: 1218 ARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVP---LPGPGSPEVKRAHGTPPPVSPKP 1274
            A K  + PV   P   +            +        P P  P+       P   S   
Sbjct: 142  ALKEGEDPVPGPPETEEGDEDELDGTEDAAGSGRSESEPQPPPPDSATPGEEPNLPSDPA 201

Query: 1275 PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAP 1334
             PP +A      +   P+ +      P     PP   +    +  SL ++P+  PS   P
Sbjct: 202  DPPSSAESNDLDLPLHPASNDSEISLPPAPPAPPDTDSSSEPSTSSLPSTPSNLPSDAPP 261

Query: 1335 ALHVPAKPPRAAAAAA-AAAAAPPAPPEGASPGDSARQKLEE 1375
               VP+ P +    A  A    P    E          ++ +
Sbjct: 262  PTQVPSPPSQQPTPAVPAPPPPPYLTLEVLGSIQPRPDQIAQ 303



 Score = 42.8 bits (101), Expect = 1e-04
 Identities = 39/176 (22%), Positives = 52/176 (29%), Gaps = 22/176 (12%)

Query: 1184 EQAGPPELPPPPPPAEPPPTDL-------AHLPPLPPPEGEARKPAKPPVSPKPVLTQPV 1236
             + G   +P PP   E    +L               P+      A P   P        
Sbjct: 143  LKEGEDPVPGPPETEEGDEDELDGTEDAAGSGRSESEPQPPPPDSATPGEEPNLPSDPAD 202

Query: 1237 PKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAG 1296
            P       P+S +              H          PP P AP    +    PS S+ 
Sbjct: 203  P-------PSSAESNDLDLPL------HPASNDSEISLPPAPPAPPDTDSS-SEPSTSSL 248

Query: 1297 PS-PAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAA 1351
            PS P+  P+  PP      P +     A PA PP P      + +  PR    A A
Sbjct: 249  PSTPSNLPSDAPPPTQVPSPPSQQPTPAVPAPPPPPYLTLEVLGSIQPRPDQIAQA 304



 Score = 41.3 bits (97), Expect = 5e-04
 Identities = 31/160 (19%), Positives = 38/160 (23%), Gaps = 14/160 (8%)

Query: 1161 PEPPPPL--SVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEA 1218
            P P PP       +          S ++     PPPP  A P         P  PP    
Sbjct: 149  PVPGPPETEEGDEDELDGTEDAAGSGRSESEPQPPPPDSATPGEEPNLPSDPADPPSSAE 208

Query: 1219 RKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPP 1278
                  P+ P          L  +P              P       TP  +    PPP 
Sbjct: 209  SNDLDLPLHPAS--NDSEISLPPAPPAPP---DTDSSSEPSTSSLPSTPSNLPSDAPPPT 263

Query: 1279 TAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTP 1318
              P P       PS    P+    P              P
Sbjct: 264  QVPSP-------PSQQPTPAVPAPPPPPYLTLEVLGSIQP 296



 Score = 39.3 bits (92), Expect = 0.002
 Identities = 24/139 (17%), Positives = 35/139 (25%), Gaps = 5/139 (3%)

Query: 1152 PKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPL 1211
                +                        P  E   P +   PP  AE    DL   P  
Sbjct: 161  EDELDGTEDAAGSGRSESEPQPPPPDSATPGEEPNLPSDPADPPSSAESNDLDLPLHPAS 220

Query: 1212 PPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVS 1271
               E        PP  P P  T    +   S  P++          P    +  +  P  
Sbjct: 221  NDSEISL-----PPAPPAPPDTDSSSEPSTSSLPSTPSNLPSDAPPPTQVPSPPSQQPTP 275

Query: 1272 PKPPPPPTAPKPVKAVAGL 1290
              P PPP     ++ +  +
Sbjct: 276  AVPAPPPPPYLTLEVLGSI 294



 Score = 31.6 bits (72), Expect = 0.33
 Identities = 44/217 (20%), Positives = 60/217 (27%), Gaps = 45/217 (20%)

Query: 605 LQKAEYAKYEGGPLRRKAPQSLEVMAIESPPPPEPTPADCQSPKMTTFQDSELSDELQAA 664
            QK +YAK++   + +         A++    P P P +          +    DEL   
Sbjct: 126 AQKIKYAKWKAARIAK---------ALKEGEDPVPGPPE---------TEEGDEDELDG- 166

Query: 665 MTGPAEVGPTTEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRS 724
            T  A     +E      PP       + +     A   SS++    D P  P+S  S  
Sbjct: 167 -TEDAAGSGRSESEPQPPPPDSATPGEEPNLPSDPADPPSSAESNDLDLPLHPASNDSEI 225

Query: 725 QEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTR 784
                   PAP  PP                    P        P       P       
Sbjct: 226 SLP-----PAPPAPPDT-------------DSSSEPSTSSLPSTPSNLPSDAPPPTQVPS 267

Query: 785 PGSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPR 821
           P S Q       P PA     P P L       + PR
Sbjct: 268 PPSQQ-------PTPAVPAPPPPPYLTLEVLGSIQPR 297


>gnl|CDD|118562 pfam10033, ATG13, Autophagy-related protein 13.  Members of this
            family of phosphoproteins are involved in cytoplasm to
            vacuole transport (Cvt), and more specifically in Cvt
            vesicle formation. They are probably involved in the
            switching machinery regulating the conversion between the
            Cvt pathway and autophagy. Finally, ATG13 is also
            required for glycogen storage.
          Length = 558

 Score = 42.5 bits (100), Expect = 2e-04
 Identities = 31/145 (21%), Positives = 42/145 (28%), Gaps = 9/145 (6%)

Query: 1167 LSVYHNGTGTVRRRPASE-QAGPPELPPPPPPAEPPPTDLAHLPP-------LPPPEGEA 1218
            ++     + T    P    +A        PPP       L    P       +    G  
Sbjct: 244  ITDDEGVSPTTDPSPIFALRAARSSGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSP 303

Query: 1219 RKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPP 1278
                 P VS +P     +    G P+ +S   P   PGS          PP S       
Sbjct: 304  SAGRSPSVSFQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPPSLSASSST 363

Query: 1279 TAPKPVKAVAGLPSGSAGPSPAPSP 1303
            + P+     A   S S G SP P  
Sbjct: 364  SPPRSPSG-ALSSSSSGGSSPGPIS 387



 Score = 41.7 bits (98), Expect = 4e-04
 Identities = 26/130 (20%), Positives = 44/130 (33%), Gaps = 4/130 (3%)

Query: 1241 GSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPA 1300
               T  S    L    S        +PPP S       +      ++  + +G   PS  
Sbjct: 251  SPTTDPSPIFALRAARS----SGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSPSAG 306

Query: 1301 PSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPP 1360
             SP+       A      P L +S + P  P AP     +   + +   + +A++  +PP
Sbjct: 307  RSPSVSFQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPPSLSASSSTSPP 366

Query: 1361 EGASPGDSAR 1370
               S   S+ 
Sbjct: 367  RSPSGALSSS 376



 Score = 38.6 bits (90), Expect = 0.003
 Identities = 21/133 (15%), Positives = 36/133 (27%), Gaps = 5/133 (3%)

Query: 1192 PPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPV----PKLQGSPTPTS 1247
               P P               PP G + + +     P     + V           +P+ 
Sbjct: 253  TTDPSPIFALRAA-RSSGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSPSAGRSPSV 311

Query: 1248 KKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQP 1307
               P              +  P SP   P  ++       +  PS SA  S +P  +   
Sbjct: 312  SFQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPPSLSASSSTSPPRSPSG 371

Query: 1308 PAALAKPPGTPPS 1320
              + +   G+ P 
Sbjct: 372  ALSSSSSGGSSPG 384



 Score = 38.6 bits (90), Expect = 0.003
 Identities = 27/128 (21%), Positives = 35/128 (27%), Gaps = 2/128 (1%)

Query: 1209 PPLPPPEGEAR-KPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGT- 1266
               P P    R   +    SP P  +  V      P   S +  L GPGSP   R+    
Sbjct: 253  TTDPSPIFALRAARSSGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSPSAGRSPSVS 312

Query: 1267 PPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPA 1326
              P                +    P      S +      PP +L+    T P    S A
Sbjct: 313  FQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPPSLSASSSTSPPRSPSGA 372

Query: 1327 KPPSPGAP 1334
               S    
Sbjct: 373  LSSSSSGG 380



 Score = 37.5 bits (87), Expect = 0.008
 Identities = 24/158 (15%), Positives = 40/158 (25%), Gaps = 9/158 (5%)

Query: 703 MSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGK 762
           + SS+ +  D    P++  S              +PP  +       S +  S       
Sbjct: 238 LLSSRFITDDEGVSPTTDPSPIFALRAARSSGSASPPPGSSSRVSLQSERPHSWSIESVL 297

Query: 763 PRQVLPPGTSHFTPPQTPTKTRP--GSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSP 820
                P      +    P K      SP        P+P  A    +       +    P
Sbjct: 298 AGPGSPSAGRSPSVSFQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQA--KYSPPP 355

Query: 821 RSLPQSPTHRGFAYVLPQPVEGEVGPAAPGPAPPPVPT 858
                S T          P       ++ G +P P+  
Sbjct: 356 SLSASSSTS-----PPRSPSGALSSSSSGGSSPGPISR 388



 Score = 33.6 bits (77), Expect = 0.088
 Identities = 29/116 (25%), Positives = 42/116 (36%), Gaps = 16/116 (13%)

Query: 1270 VSPKPPPPPTAPKPVKAVAG-----LPSGSAGPSPAPSPARQPPAALAKPPGTP-----P 1319
            VSP   P P         +G       S S     +  P      ++   PG+P     P
Sbjct: 250  VSPTTDPSPIFALRAARSSGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSPSAGRSP 309

Query: 1320 SLGASPAKPP----SPGAPALHVPAKPP--RAAAAAAAAAAAPPAPPEGASPGDSA 1369
            S+   P K      SPG P+   P  PP    ++++++ A   P P   AS   S 
Sbjct: 310  SVSFQPFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPPSLSASSSTSP 365



 Score = 32.4 bits (74), Expect = 0.23
 Identities = 29/173 (16%), Positives = 46/173 (26%), Gaps = 13/173 (7%)

Query: 616 GPLRRKAPQSLEVMAIESPPPPEPTPADCQSPKMTTFQ-----DSELSDELQAAMT---G 667
            P    A ++       SPPP   +    QS +  ++          S     + +    
Sbjct: 255 DPSPIFALRAARSSGSASPPPGSSSRVSLQSERPHSWSIESVLAGPGSPSAGRSPSVSFQ 314

Query: 668 PAEVGPTTEKPS--SHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQ 725
           P + G  +  P   S   P         SS   +A++      L       P    S + 
Sbjct: 315 PFKAGSLSASPGLPSSSSPPSPPFAPGSSSSSSQAKYSPPP-SLSASSSTSPPRSPSGAL 373

Query: 726 EYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQ 778
                 G +PG   R +    H     R S               +S    P 
Sbjct: 374 SSSSSGGSSPGPISRYSSSFGHRRR--RPSSGGSNSLEDSSGKSSSSSSAQPG 424


>gnl|CDD|118263 pfam09731, Mitofilin, Mitochondrial inner membrane protein.
            Mitofilin controls mitochondrial cristae morphology.
            Mitofilin is enriched in the narrow space between the
            inner boundary and the outer membranes, where it forms a
            homotypic interaction and assembles into a large
            multimeric protein complex. The first 78 amino acids
            contain a typical amino-terminal-cleavable mitochondrial
            presequence (residues 1-43) rich in positive-charged and
            hydroxylated residues and a membrane anchor domain
            (residues 47-66). In addition, it has three centrally
            located coiled coil domains (residues 200-240,280-310 and
            400-420).
          Length = 739

 Score = 41.5 bits (97), Expect = 4e-04
 Identities = 33/124 (26%), Positives = 44/124 (35%), Gaps = 10/124 (8%)

Query: 1275 PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQP-PAALAKPPGTPPSLGASPAKPPSPGA 1333
            P P   P P K     P   +  S     ++QP      K    PPS        P+P  
Sbjct: 95   PAPYDVPLPKKPEQSGPLKISSVSEVMKDSKQPVAQGQKKKGEKPPSAAGDTLSVPAPKV 154

Query: 1334 PALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQ 1393
                 P  P +  +  AA + AP A  E AS      +  EE +A L     A +EK  Q
Sbjct: 155  ----QPEDPVKTPSPPAAESKAPAATSEEASSSSVRERPPEEVAARL-----AQQEKQEQ 205

Query: 1394 EDAQ 1397
               +
Sbjct: 206  VKIE 209



 Score = 39.5 bits (92), Expect = 0.001
 Identities = 25/131 (19%), Positives = 40/131 (30%), Gaps = 24/131 (18%)

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPP-------------LPPPEGEARKPAKPPVS 1227
            P S++     L P P     P       P               P  +G+ +K  KPP +
Sbjct: 83   PYSDKLFEMVLGPAPYDVPLPKKPEQSGPLKISSVSEVMKDSKQPVAQGQKKKGEKPPSA 142

Query: 1228 PKPVLTQPVPKLQGSPTPTSKKVPLPGPG-SPEVKRAHGTPPPVSPKPP---------PP 1277
                L+ P PK+Q    P     P      +P       +   V  +PP           
Sbjct: 143  AGDTLSVPAPKVQPED-PVKTPSPPAAESKAPAATSEEASSSSVRERPPEEVAARLAQQE 201

Query: 1278 PTAPKPVKAVA 1288
                  ++++A
Sbjct: 202  KQEQVKIESLA 212



 Score = 34.5 bits (79), Expect = 0.052
 Identities = 26/127 (20%), Positives = 43/127 (33%), Gaps = 21/127 (16%)

Query: 1265 GTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGAS 1324
                    K   PP+A     +V             P+P  QP   +  P  +PP   A+
Sbjct: 127  PVAQGQKKKGEKPPSAAGDTLSV-------------PAPKVQPEDPVKTP--SPP---AA 168

Query: 1325 PAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLA-AA 1383
             +K P+  +      +   R     AA  A      +     +S  + LE+  +  A   
Sbjct: 169  ESKAPAATSEEASSSSVRERPPEEVAARLAQQ--EKQEQVKIESLAKSLEDALSQTAVVT 226

Query: 1384 LQAVEEK 1390
            LQA+  +
Sbjct: 227  LQAITAQ 233


>gnl|CDD|116041 pfam07420, DUF1509, Protein of unknown function (DUF1509).  This
            family consists of several uncharacterised viral proteins
            from the Marek's disease-like viruses. Members of this
            family are typically around 400 residues in length. The
            function of this family is unknown.
          Length = 377

 Score = 41.2 bits (96), Expect = 5e-04
 Identities = 39/137 (28%), Positives = 49/137 (35%), Gaps = 17/137 (12%)

Query: 1158 EAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPP-------PPPPAEPPPTDL----- 1205
             +G +  P  S    G+G  R RP   Q    +  P       P P A   P+ +     
Sbjct: 139  SSGDDDGPSTS---RGSGVARVRPTVIQHRVDKTRPSDYENHRPRPFAMANPSWVDEPDA 195

Query: 1206 -AHLPPLPPPEGEARKPAKPPVSPKPVLTQPVP-KLQGSPTPTSKKVPLPGPGSPEVKRA 1263
             A  PP P P G+ R P  P +S   VL  PV      +P+P       P P      RA
Sbjct: 196  AAQRPPQPGPSGQNRSPRTPTLSNVRVLDAPVATNRGEAPSPPRTDTLDPDPAIAGPSRA 255

Query: 1264 HGTPPPVSPKPPPPPTA 1280
                P   P  PPP   
Sbjct: 256  VNRTPSPRPSSPPPEID 272


>gnl|CDD|114251 pfam05518, Totivirus_coat, Totivirus coat protein. 
          Length = 753

 Score = 41.3 bits (97), Expect = 5e-04
 Identities = 30/139 (21%), Positives = 41/139 (29%), Gaps = 4/139 (2%)

Query: 1217 EARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKV-PLPGPGSPEVKRAHGTPPPVSPKPP 1275
            +AR   +  V    +   P       P P   +     GPG P          P     P
Sbjct: 618  QARTFGRATVGEMIISGFPPVFKTALPRPDYNRGGEAGGPGVPGPVPVGM---PAHTARP 674

Query: 1276 PPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPA 1335
                   PV+  A   +  A  +P P         L  PP  P + G +P       +P 
Sbjct: 675  SRVARGDPVRPTAHHAALRAPQAPRPGGPPGGGGGLPPPPDLPAAAGPAPCGSSLIASPT 734

Query: 1336 LHVPAKPPRAAAAAAAAAA 1354
                 +PP A  A  A   
Sbjct: 735  APPEPEPPGAEQADGAENQ 753



 Score = 40.2 bits (94), Expect = 0.001
 Identities = 23/121 (19%), Positives = 29/121 (23%), Gaps = 15/121 (12%)

Query: 1265 GTPPPVSPKPPPPPTAPKPVKAV------AGLPSGSAGPSPAPSPARQPP--------AA 1310
               PPV     P P   +  +A              A  +     AR  P        A 
Sbjct: 633  SGFPPVFKTALPRPDYNRGGEAGGPGVPGPVPVGMPAHTARPSRVARGDPVRPTAHHAAL 692

Query: 1311 LAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSAR 1370
             A     P          P P          P  ++  A+  A   P PP      D A 
Sbjct: 693  RAPQAPRPGGPPGGGGGLPPPPDLPAAAGPAPCGSSLIASPTAPPEPEPPGAE-QADGAE 751

Query: 1371 Q 1371
             
Sbjct: 752  N 752



 Score = 36.3 bits (84), Expect = 0.016
 Identities = 34/137 (24%), Positives = 42/137 (30%), Gaps = 25/137 (18%)

Query: 738 PPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGSPQALGGPHGP 797
             + A P    +    A  P VPG P  V  P   H   P    +         G P  P
Sbjct: 638 VFKTALPRPDYNRGGEAGGPGVPG-PVPVGMPA--HTARPSRVAR---------GDPVRP 685

Query: 798 APATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPAAPGPAPPPVP 857
               A ++      P   RP         P   G     P  +    GPA  G +    P
Sbjct: 686 TAHHAALRA-----PQAPRP-------GGPPGGGGGLPPPPDLPAAAGPAPCGSSLIASP 733

Query: 858 TAVPTLCLPPEADAEPG 874
           TA P    PP A+   G
Sbjct: 734 TAPPEP-EPPGAEQADG 749



 Score = 35.2 bits (81), Expect = 0.031
 Identities = 20/106 (18%), Positives = 26/106 (24%), Gaps = 5/106 (4%)

Query: 1179 RRPASEQAGPPE---LPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQP 1235
                 E  GP     +P   P     P+ +A   P+ P    A   A     P       
Sbjct: 648  YNRGGEAGGPGVPGPVPVGMPAHTARPSRVARGDPVRPTAHHAALRAPQAPRPGGPPGGG 707

Query: 1236 VPKLQGSPTPTSKKVPLPGPGS-PEVKRAHGTPPPVSPKPPPPPTA 1280
               L   P   +   P P   S      A   P P   +       
Sbjct: 708  G-GLPPPPDLPAAAGPAPCGSSLIASPTAPPEPEPPGAEQADGAEN 752



 Score = 33.6 bits (77), Expect = 0.10
 Identities = 23/130 (17%), Positives = 31/130 (23%)

Query: 1172 NGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPV 1231
             G  TV     S      +   P P             P P P G     A+P    +  
Sbjct: 622  FGRATVGEMIISGFPPVFKTALPRPDYNRGGEAGGPGVPGPVPVGMPAHTARPSRVARGD 681

Query: 1232 LTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLP 1291
              +P         P + +   P  G   +      P    P P        P       P
Sbjct: 682  PVRPTAHHAALRAPQAPRPGGPPGGGGGLPPPPDLPAAAGPAPCGSSLIASPTAPPEPEP 741

Query: 1292 SGSAGPSPAP 1301
             G+     A 
Sbjct: 742  PGAEQADGAE 751



 Score = 32.8 bits (75), Expect = 0.18
 Identities = 24/119 (20%), Positives = 30/119 (25%), Gaps = 5/119 (4%)

Query: 1212 PPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVS 1271
            P  +    +P             P P   G P  T++       G P    AH       
Sbjct: 637  PVFKTALPRPDYNRGGEAGGPGVPGPVPVGMPAHTAR-PSRVARGDPVRPTAHHAALRAP 695

Query: 1272 PKP-PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPP 1329
              P P  P               +AGP+P  S     P A   PP   P          
Sbjct: 696  QAPRPGGPPGGGGGLPPPPDLPAAAGPAPCGSSLIASPTA---PPEPEPPGAEQADGAE 751



 Score = 30.5 bits (69), Expect = 0.83
 Identities = 22/99 (22%), Positives = 28/99 (28%), Gaps = 10/99 (10%)

Query: 1279 TAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGT-PPSLGASPAKPPSP--GAPA 1335
             A      ++G P       P P   R   A     PG  P  + A  A+P     G P 
Sbjct: 624  RATVGEMIISGFPPVFKTALPRPDYNRGGEAGGPGVPGPVPVGMPAHTARPSRVARGDPV 683

Query: 1336 LHVPA-------KPPRAAAAAAAAAAAPPAPPEGASPGD 1367
                        + PR           PP P   A+ G 
Sbjct: 684  RPTAHHAALRAPQAPRPGGPPGGGGGLPPPPDLPAAAGP 722


>gnl|CDD|115804 pfam07174, FAP, Fibronectin-attachment protein (FAP).  This family
            contains bacterial fibronectin-attachment proteins (FAP).
            Family members are rich in alanine and proline, are
            approximately 300 long, and seem to be restricted to
            mycobacteria. These proteins contain a
            fibronectin-binding motif that allows mycobacteria to
            bind to fibronectin in the extracellular matrix.
          Length = 297

 Score = 41.4 bits (97), Expect = 5e-04
 Identities = 21/84 (25%), Positives = 27/84 (32%), Gaps = 5/84 (5%)

Query: 1263 AHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLG 1322
            A+  P P    P     AP P       P     P+  P+P    P A   PP   P+  
Sbjct: 37   ANADPAPPPSPPSTAAAAPAPAP-----PPPPPPPAAPPAPQPGDPNAAPPPPPADPNAP 91

Query: 1323 ASPAKPPSPGAPALHVPAKPPRAA 1346
              P   P+   P    P +   A 
Sbjct: 92   PPPPVDPNAPPPPAPEPGRIDNAV 115



 Score = 36.8 bits (85), Expect = 0.010
 Identities = 26/81 (32%), Positives = 30/81 (37%), Gaps = 1/81 (1%)

Query: 1286 AVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRA 1345
            AVA   + +A P+P PSP     AA A P   PP    +    P PG P    P  P   
Sbjct: 30   AVALPATANADPAPPPSPPSTAAAAPA-PAPPPPPPPPAAPPAPQPGDPNAAPPPPPADP 88

Query: 1346 AAAAAAAAAAPPAPPEGASPG 1366
             A           PP    PG
Sbjct: 89   NAPPPPPVDPNAPPPPAPEPG 109



 Score = 36.0 bits (83), Expect = 0.016
 Identities = 30/112 (26%), Positives = 31/112 (27%), Gaps = 13/112 (11%)

Query: 1258 PEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGT 1317
            P    A   PPP  P       AP P             P PA  PA QP      P   
Sbjct: 34   PATANADPAPPPSPPSTAAAAPAPAPPPPP---------PPPAAPPAPQP----GDPNAA 80

Query: 1318 PPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSA 1369
            PP   A P  PP P       P   P       A        P G    D+ 
Sbjct: 81   PPPPPADPNAPPPPPVDPNAPPPPAPEPGRIDNAVGGFSYVVPAGWVESDAT 132



 Score = 35.6 bits (82), Expect = 0.024
 Identities = 27/75 (36%), Positives = 32/75 (42%), Gaps = 1/75 (1%)

Query: 1286 AVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRA 1345
            A+A +   SA     P+ A   PA    PP T  +  A PA PP P  PA     +P   
Sbjct: 19   AIAAVAGASAVAVALPATANADPAPPPSPPSTAAAAPA-PAPPPPPPPPAAPPAPQPGDP 77

Query: 1346 AAAAAAAAAAPPAPP 1360
             AA     A P APP
Sbjct: 78   NAAPPPPPADPNAPP 92



 Score = 34.1 bits (78), Expect = 0.066
 Identities = 24/82 (29%), Positives = 27/82 (32%), Gaps = 5/82 (6%)

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQ 1240
            PA+  A P   P PP  A   P      P  PPP      P  P          P P   
Sbjct: 34   PATANADPAPPPSPPSTAAAAPA-----PAPPPPPPPPAAPPAPQPGDPNAAPPPPPADP 88

Query: 1241 GSPTPTSKKVPLPGPGSPEVKR 1262
             +P P       P P +PE  R
Sbjct: 89   NAPPPPPVDPNAPPPPAPEPGR 110



 Score = 32.2 bits (73), Expect = 0.28
 Identities = 31/117 (26%), Positives = 35/117 (29%), Gaps = 13/117 (11%)

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPV-PKL 1239
            PA   + P      P PA PPP      PP P P      P  PP  P      PV P  
Sbjct: 41   PAPPPSPPSTAAAAPAPAPPPPPPPPAAPPAPQPGDPNAAPPPPPADPNAPPPPPVDPNA 100

Query: 1240 QGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVS------------PKPPPPPTAPKPV 1284
               P P   ++     G   V  A       +               PP P  P PV
Sbjct: 101  PPPPAPEPGRIDNAVGGFSYVVPAGWVESDATHLDYGSALLSKTTGEPPMPGQPPPV 157


>gnl|CDD|112106 pfam03276, Gag_spuma, Spumavirus gag protein. 
          Length = 592

 Score = 39.5 bits (92), Expect = 0.002
 Identities = 22/94 (23%), Positives = 30/94 (31%), Gaps = 1/94 (1%)

Query: 1269 PVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKP 1328
            P    PP     P    + A  PS S+ P+  P         L++     P + +  + P
Sbjct: 182  PAPRPPPSSIPQPSAPSSQAPAPSPSSAPADLPWSPGPSDPRLSRVAYN-PFIESDGSGP 240

Query: 1329 PSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEG 1362
              P AP    P   P   A         P PP  
Sbjct: 241  RQPSAPPRREPLPAPAPGAQPMIQYVPVPPPPAP 274



 Score = 39.1 bits (91), Expect = 0.002
 Identities = 25/92 (27%), Positives = 33/92 (35%), Gaps = 9/92 (9%)

Query: 1269 PVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKP 1328
            P +P P PPP++          PS  +  +PAPSP+  P      P  + P L      P
Sbjct: 179  PGAPAPRPPPSSI-------PQPSAPSSQAPAPSPSSAPADLPWSPGPSDPRLSRVAYNP 231

Query: 1329 PSPGAPALHVPAKPPRAAAAAAAAAAAPPAPP 1360
                      P +P          A AP A P
Sbjct: 232  FIESDG--SGPRQPSAPPRREPLPAPAPGAQP 261



 Score = 34.1 bits (78), Expect = 0.060
 Identities = 30/114 (26%), Positives = 42/114 (36%), Gaps = 16/114 (14%)

Query: 1178 RRRPASEQAGPPELPPPPPPAEPP-PTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQ-- 1234
             +        P    P PPP+  P P+  +   P P P          P    P L++  
Sbjct: 169  GQLQGLRGNLPGAPAPRPPPSSIPQPSAPSSQAPAPSPSSAPADLPWSPGPSDPRLSRVA 228

Query: 1235 --PVPKLQGS----PTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPK 1282
              P  +  GS    P+   ++ PLP P       A G  P +   P PPP AP+
Sbjct: 229  YNPFIESDGSGPRQPSAPPRREPLPAP-------APGAQPMIQYVPVPPPPAPQ 275



 Score = 33.0 bits (75), Expect = 0.13
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 6/102 (5%)

Query: 1159 AGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEA 1218
            A    PPP S+      + +    S  + P +LP  P P++P  + +A+ P +       
Sbjct: 181  APAPRPPPSSIPQPSAPSSQAPAPSPSSAPADLPWSPGPSDPRLSRVAYNPFIESDGSGP 240

Query: 1219 RKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEV 1260
            R+P+ PP        +P+P       P  + VP+P P +P+V
Sbjct: 241  RQPSAPPRR------EPLPAPAPGAQPMIQYVPVPPPPAPQV 276


>gnl|CDD|115852 pfam07223, DUF1421, Protein of unknown function (DUF1421).  This
            family represents a conserved region approximately 350
            residues long within a number of plant proteins of
            unknown function.
          Length = 363

 Score = 38.8 bits (90), Expect = 0.002
 Identities = 39/183 (21%), Positives = 51/183 (27%), Gaps = 7/183 (3%)

Query: 1184 EQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSP 1243
            E A  P       PA+ P   L    P       A  P  P   P        P+ Q   
Sbjct: 49   ELAVVPLQQTAQSPADVPSQQLNGALPQLVASSLAPSPQ-PQQQPPSQAPGYPPQSQVPI 107

Query: 1244 TPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSP 1303
             P   + P      P  +     PPPV       P AP+         +    P      
Sbjct: 108  VPPQAQYPQEPYYPPPSQVQQNAPPPVVQPQYSQPPAPQTQSPHQPPQAYQPPPQQPQYS 167

Query: 1304 ARQPPAALAKPPGTPPSLGAS-----PAKPPSPGAPALHVPAKP-PRAAAAAAAAAAAPP 1357
              QPP    +P  + P    S      + PP       + P +P P +          P 
Sbjct: 168  QYQPPPQSVQPQTSSPPQAQSAPQVPQSYPPYSPQQPPNAPPEPLPGSMPMQPPYQGPPE 227

Query: 1358 APP 1360
            A P
Sbjct: 228  ANP 230



 Score = 37.7 bits (87), Expect = 0.005
 Identities = 39/218 (17%), Positives = 63/218 (28%), Gaps = 13/218 (5%)

Query: 1162 EPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKP 1221
            +PP     Y   +      P ++    P  PPP    +  P  +       PP  + + P
Sbjct: 91   QPPSQAPGYPPQSQVPIVPPQAQYPQEPYYPPPSQVQQNAPPPVVQPQYSQPPAPQTQSP 150

Query: 1222 AKPPVSPKPVLTQP-VPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTA 1280
             +PP + +P   QP   + Q  P     +   P       +     PP    +PP  P  
Sbjct: 151  HQPPQAYQPPPQQPQYSQYQPPPQSVQPQTSSPPQAQSAPQVPQSYPPYSPQQPPNAPPE 210

Query: 1281 PKPVKAVAGLP------------SGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKP 1328
            P P       P             G  G   +  P  Q     +          + P   
Sbjct: 211  PLPGSMPMQPPYQGPPEANPSMYGGPGGRPNSGPPPSQSYGPQSGGGFPEKYGYSGPPSY 270

Query: 1329 PSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPG 1366
               G   ++  A    +  ++  +A  P  P     P 
Sbjct: 271  SVQGNAQMYNAAYFNPSNCSSTGSAVYPQLPQASPLPQ 308



 Score = 36.5 bits (84), Expect = 0.012
 Identities = 42/220 (19%), Positives = 61/220 (27%), Gaps = 14/220 (6%)

Query: 1163 PPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPP--------PTDLAHLPPLPPP 1214
            P P                +     PP+   P  P  PP        P  +       PP
Sbjct: 84   PSPQPQQQPPSQAPGYPPQSQVPIVPPQAQYPQEPYYPPPSQVQQNAPPPVVQPQYSQPP 143

Query: 1215 EGEARKPAKPPVSPKPVLTQP-VPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPK 1273
              + + P +PP + +P   QP   + Q  P     +   P       +     PP    +
Sbjct: 144  APQTQSPHQPPQAYQPPPQQPQYSQYQPPPQSVQPQTSSPPQAQSAPQVPQSYPPYSPQQ 203

Query: 1274 PPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASP-AKPPSPG 1332
            PP  P  P P            GP P  +P+           G PPS    P +    P 
Sbjct: 204  PPNAPPEPLPGSMPM--QPPYQGP-PEANPSMYGGPGGRPNSGPPPSQSYGPQSGGGFPE 260

Query: 1333 APALH-VPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQ 1371
                   P+   +  A    AA   P+           + 
Sbjct: 261  KYGYSGPPSYSVQGNAQMYNAAYFNPSNCSSTGSAVYPQL 300



 Score = 35.4 bits (81), Expect = 0.033
 Identities = 48/228 (21%), Positives = 73/228 (32%), Gaps = 15/228 (6%)

Query: 1153 KAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAE---PPPTDLAHLP 1209
             A+     P      ++      ++   P  +Q  P + P  PP ++    PP       
Sbjct: 58   TAQSPADVPSQQLNGALPQLVASSLAPSPQPQQQPPSQAPGYPPQSQVPIVPPQAQYPQE 117

Query: 1210 PLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPP 1269
            P  PP  + ++ A PPV        P P+ Q    P     P P     + + +   PPP
Sbjct: 118  PYYPPPSQVQQNAPPPVVQPQYSQPPAPQTQSPHQPPQAYQPPP----QQPQYSQYQPPP 173

Query: 1270 --VSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQP-----PAALAKPPGTPPSLG 1322
              V P+   PP A    +     P  S    P   P   P           PP   PS+ 
Sbjct: 174  QSVQPQTSSPPQAQSAPQVPQSYPPYSPQQPPNAPPEPLPGSMPMQPPYQGPPEANPSMY 233

Query: 1323 ASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPA-PPEGASPGDSA 1369
              P   P+ G P                   + PP+   +G +   +A
Sbjct: 234  GGPGGRPNSGPPPSQSYGPQSGGGFPEKYGYSGPPSYSVQGNAQMYNA 281



 Score = 34.6 bits (79), Expect = 0.047
 Identities = 36/167 (21%), Positives = 47/167 (28%), Gaps = 3/167 (1%)

Query: 1207 HLPPLPPPEGEARKPAKPPVSPKP-VLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHG 1265
            H   + P +  A+ PA  P       L Q V           ++ P   PG P   +   
Sbjct: 48   HELAVVPLQQTAQSPADVPSQQLNGALPQLVASSLAPSPQPQQQPPSQAPGYPPQSQVPI 107

Query: 1266 TPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASP 1325
             PP       P    P  V+  A  P      S  P+P  Q P    +    PP      
Sbjct: 108  VPPQAQYPQEPYYPPPSQVQQNAPPPVVQPQYSQPPAPQTQSPHQPPQAYQPPPQQPQYS 167

Query: 1326 AK--PPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSAR 1370
                PP    P    P +   A     +     P  P  A P     
Sbjct: 168  QYQPPPQSVQPQTSSPPQAQSAPQVPQSYPPYSPQQPPNAPPEPLPG 214



 Score = 30.7 bits (69), Expect = 0.69
 Identities = 36/170 (21%), Positives = 48/170 (28%), Gaps = 9/170 (5%)

Query: 1163 PPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPA 1222
             PPP    ++      +    + + PP+    P   +  P      PP  PPE       
Sbjct: 158  QPPPQQPQYSQYQPPPQSVQPQTSSPPQAQSAPQVPQSYPPYSPQQPPNAPPEPLPGSMP 217

Query: 1223 KPPVSPKPVLTQP-------VPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPP 1275
              P    P    P            G P P+    P  G G PE     G PP  S +  
Sbjct: 218  MQPPYQGPPEANPSMYGGPGGRPNSGPP-PSQSYGPQSGGGFPEKYGYSG-PPSYSVQGN 275

Query: 1276 PPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASP 1325
                            +GSA     P  +  P A       +P S    P
Sbjct: 276  AQMYNAAYFNPSNCSSTGSAVYPQLPQASPLPQALPMGHSLSPQSGNRHP 325


>gnl|CDD|118767 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3.  This protein,
            which interacts with both microtubules and TRAF3 (tumour
            necrosis factor receptor-associated factor 3), is
            conserved from worms to humans. The N-terminal region is
            the microtubule binding domain and is well-conserved; the
            C-terminal 100 residues, also well-conserved, constitute
            the coiled-coil region which binds to TRAF3. The central
            region of the protein is rich in lysine and glutamic acid
            and carries KKE motifs which may also be necessary for
            tubulin-binding, but this region is the least
            well-conserved.
          Length = 504

 Score = 37.9 bits (88), Expect = 0.005
 Identities = 41/240 (17%), Positives = 68/240 (28%), Gaps = 5/240 (2%)

Query: 1063 RRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEASA 1122
            R+   G   G  A  +         G   E    +++     K E   E     K +  A
Sbjct: 78   RKVEKGDSKGKAAKTKPEQEPKNRSGREKEAKKEKKKEEKKKKKEKPQEEKKKRKPKEEA 137

Query: 1123 TLKRRIR--AKQNQQENVKFILTESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRR 1180
               R  +   K  +++       E ++ ++  K K RE  P+   P +         +++
Sbjct: 138  EEPRPPKEKEKDKEKKKKAPKDREKESERKEEKEKSREKSPKKKDPKNEKKEPPEKEKKK 197

Query: 1181 PASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQ 1240
             A  +    + P      E    D            E    +K            + K  
Sbjct: 198  QAERKQVSGKTPEEDVNEEEEKPDDEGKDRETRTSPEEEPESKKSEEKSRESPGSLKKED 257

Query: 1241 GSPTPTSKKVPLPGPGSPEVKRAHGTPP---PVSPKPPPPPTAPKPVKAVAGLPSGSAGP 1297
               +  +  V       P   R    PP   P S +P PP    K +  V   P G    
Sbjct: 258  PPKSLETPAVVTIQVRIPTESRPSARPPRPRPASARPAPPRVKRKQIATVLQDPQGVGEL 317



 Score = 37.6 bits (87), Expect = 0.006
 Identities = 41/227 (18%), Positives = 68/227 (29%), Gaps = 9/227 (3%)

Query: 1093 DGTGRQRPRGPSKGEAGVEGPPLAKVEASATLKRRIRAKQNQQENVKFILTESDTVKRRP 1152
            D  G+     P +      G      +     +++ + ++ Q+E  K    E     R P
Sbjct: 84   DSKGKAAKTKPEQEPKNRSGREKEAKKEKKKEEKKKKKEKPQEEKKKRKPKEEAEEPRPP 143

Query: 1153 KAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLP 1212
            K KE++   +   P       +     +  S +  P +  P     EPP  +        
Sbjct: 144  KEKEKDKEKKKKAPKD-REKESERKEEKEKSREKSPKKKDPKNEKKEPPEKE-----KKK 197

Query: 1213 PPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSP 1272
              E +      P         +P  + +   T TS +       S E  R          
Sbjct: 198  QAERKQVSGKTPEEDVNEEEEKPDDEGKDRETRTSPEEEPESKKSEEKSRES-PGSLKKE 256

Query: 1273 KPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPP 1319
             PP     P  V     +P+ S   +  P P   P +A   PP    
Sbjct: 257  DPPKSLETPAVVTIQVRIPTESRPSARPPRPR--PASARPAPPRVKR 301



 Score = 35.6 bits (82), Expect = 0.027
 Identities = 33/243 (13%), Positives = 66/243 (27%), Gaps = 16/243 (6%)

Query: 1148 VKRRPKAKERE-AGPEPPPPLSVYHNGTGTVRRRPA-SEQAGPPELPPPPPPAEPPPTDL 1205
            V++  K   +  A    P       +G     ++    E+    +  P     +  P + 
Sbjct: 77   VRKVEKGDSKGKAAKTKPEQEPKNRSGREKEAKKEKKKEEKKKKKEKPQEEKKKRKPKEE 136

Query: 1206 AHLPPLPPPEGEARKPAKPPVSPKPVLTQ---------PVPKLQGSPTPTSKKVPLPGPG 1256
            A  P  P  + + ++  K     +   ++              +  P    K+ P     
Sbjct: 137  AEEPRPPKEKEKDKEKKKKAPKDREKESERKEEKEKSREKSPKKKDPKNEKKEPPEKEKK 196

Query: 1257 SPEVKRA--HGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKP 1314
                ++     TP     +    P      +     P        +   +R+ P +L K 
Sbjct: 197  KQAERKQVSGKTPEEDVNEEEEKPDDEGKDRETRTSPEEEPESKKSEEKSRESPGSLKKE 256

Query: 1315 -PGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKL 1373
             P       A           +   P+  P     A+A  A P    +  +      Q +
Sbjct: 257  DPPKSLETPAVVTIQVRIPTESR--PSARPPRPRPASARPAPPRVKRKQIATVLQDPQGV 314

Query: 1374 EET 1376
             E 
Sbjct: 315  GEL 317


>gnl|CDD|109760 pfam00716, Peptidase_S21, Assemblin (Peptidase family S21). 
          Length = 326

 Score = 37.4 bits (87), Expect = 0.007
 Identities = 18/80 (22%), Positives = 26/80 (32%), Gaps = 2/80 (2%)

Query: 1279 TAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHV 1338
                 +KA       +A        A +        PGT PS  A+P+  PS    +   
Sbjct: 201  KGHTYLKASESPGLTAACHDEVV--ASKGGNDRGVSPGTAPSFDATPSVSPSGQPLSPAA 258

Query: 1339 PAKPPRAAAAAAAAAAAPPA 1358
            P      A  A +A+ A   
Sbjct: 259  PPGTSSVAGTALSASPAALF 278



 Score = 33.2 bits (76), Expect = 0.15
 Identities = 27/111 (24%), Positives = 36/111 (32%), Gaps = 1/111 (0%)

Query: 1209 PPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPP 1268
            P L     +    +K   + + V     P    +P+ +    PL     P      GT  
Sbjct: 212  PGLTAACHDEVVASKGG-NDRGVSPGTAPSFDATPSVSPSGQPLSPAAPPGTSSVAGTAL 270

Query: 1269 PVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPP 1319
              SP          P+ A   L +G A   P       PPA LA P   PP
Sbjct: 271  SASPAALFGDMVYVPLDAYNQLLAGQAFNQPPDPQGPAPPAELAPPAPAPP 321


>gnl|CDD|113260 pfam04484, DUF566, Family of unknown function (DUF566).  Family of
            related proteins that is plant specific.
          Length = 333

 Score = 37.1 bits (86), Expect = 0.008
 Identities = 23/140 (16%), Positives = 35/140 (25%), Gaps = 9/140 (6%)

Query: 1221 PAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPG----SPEVKRAHGTPPPVSPKPPP 1276
              +   SP+       P         S+   L  P     S     A        P+   
Sbjct: 24   RPRSRSSPRSSTA--SPARFLQAPAPSRLRRLSSPSTPSSSSSSSFASSKSSGTGPRKTQ 81

Query: 1277 PPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPAL 1336
              T P      A   S     S   S     P   ++P    PS  +S    PS  + + 
Sbjct: 82   SSTKPGRSSPKALTNSPLLSSSSLSSRRSPSP---SRPAARRPSSPSSSLSSPSRASQSA 138

Query: 1337 HVPAKPPRAAAAAAAAAAAP 1356
                     +  + A+    
Sbjct: 139  TSALSGNAPSILSFASDVKR 158



 Score = 33.6 bits (77), Expect = 0.096
 Identities = 18/141 (12%), Positives = 33/141 (23%), Gaps = 2/141 (1%)

Query: 702 HMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPG 761
                          P S  +    +L    P+               S   AS      
Sbjct: 16  ENRRRLSPRPRSRSSPRSSTASPARFLQAPAPSRLRRLSSPSTPSSSSSSSFASSKSSGT 75

Query: 762 KPRQVLPPGTSHFTPPQTPTKTRPGSPQALGGPHGPAPATAKVKP--TPQLLPPTERPMS 819
            PR+         + P+  T +   S  +L     P+P+    +   +P     +    S
Sbjct: 76  GPRKTQSSTKPGRSSPKALTNSPLLSSSSLSSRRSPSPSRPAARRPSSPSSSLSSPSRAS 135

Query: 820 PRSLPQSPTHRGFAYVLPQPV 840
             +      +          V
Sbjct: 136 QSATSALSGNAPSILSFASDV 156



 Score = 32.9 bits (75), Expect = 0.15
 Identities = 28/146 (19%), Positives = 39/146 (26%), Gaps = 11/146 (7%)

Query: 921  RAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASANLADEPVPDAE--PEDGLLG 978
                 +    NRS S   R     P      RSS+A  +  L                  
Sbjct: 1    TDSEPSSVGTNRSLSENRRRLSPRPRSRSSPRSSTASPARFLQAPAPSRLRRLSSPSTPS 60

Query: 979  VRAQCRRASDLAG--------SVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTP 1030
              +    AS  +         S       S K++     LSS     R +  P       
Sbjct: 61   SSSSSSFASSKSSGTGPRKTQSSTKPGRSSPKALTNSPLLSSSSLSSRRSPSPSRPAAR- 119

Query: 1031 RPASPEPGRVATVLASVKHKEAIGPG 1056
            RP+SP     +   AS     A+   
Sbjct: 120  RPSSPSSSLSSPSRASQSATSALSGN 145


>gnl|CDD|114483 pfam05760, IER, Immediate early response protein (IER).  This family
            consists of several eukaryotic immediate early response
            (IER) 2 and 5 proteins. The role of IER5 is unclear
            although it play an important role in mediating the
            cellular response to mitogenic signals. Again, little is
            known about the function of IER2 although it is thought
            to play a role in mediating the cellular responses to a
            variety of extracellular signals.
          Length = 260

 Score = 36.9 bits (85), Expect = 0.011
 Identities = 33/136 (24%), Positives = 41/136 (30%), Gaps = 1/136 (0%)

Query: 1197 PAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPG 1256
             AE      A  P  PP    A  P  P         +            + +   P P 
Sbjct: 60   QAEQEGHLPAAPPSPPPSAARAGDPELPEEPSVRHQPREAESESELAEAAALQPEHPRPT 119

Query: 1257 SPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPG 1316
            S +        P   P+PP     P   +     PS       APSP    P+    P  
Sbjct: 120  SGQELEPLQGGPAPCPEPPRAAERPCDCRVAEEDPSVRPSEDTAPSPPAVCPSKRGAPAE 179

Query: 1317 TPPSLGASPAKPPSPG 1332
               S GA+P K P PG
Sbjct: 180  ESAS-GATPLKKPRPG 194


>gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane
            glycoprotein G. 
          Length = 408

 Score = 36.6 bits (84), Expect = 0.012
 Identities = 30/145 (20%), Positives = 42/145 (28%), Gaps = 7/145 (4%)

Query: 1194 PPPPAEPPPTD---LAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKV 1250
            P        T    L+   P+           +P   P P    P    Q  P+ TS+  
Sbjct: 199  PATQGHQTATANQRLSSTEPVGTQGTTTSSNPEPQTEPPPSQRGPSGSPQHPPSTTSQDQ 258

Query: 1251 PLPGPGSPEVKRAHGTPPPVSPKPP----PPPTAPKPVKAVAGLPSGSAGPSPAPSPARQ 1306
               G G    +R    P   + + P     PP   K  +     P  +A      SP   
Sbjct: 259  STTGDGQEHTQRRKTPPATSNRRSPHSTATPPPTTKRQETGRPTPRPTATTQSGSSPPHS 318

Query: 1307 PPAALAKPPGTPPSLGASPAKPPSP 1331
             P  +   P T   +      PP P
Sbjct: 319  SPPGVQANPTTQNLVDCKELDPPKP 343



 Score = 35.4 bits (81), Expect = 0.028
 Identities = 30/154 (19%), Positives = 44/154 (28%), Gaps = 14/154 (9%)

Query: 673 PTTEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEG 732
           P+   P S        T   +  L       +       +  P    P S+       + 
Sbjct: 190 PSQVTPQSQPATQGHQTATANQRLSSTEPVGTQGTTTSSNPEPQTEPPPSQRGPSGSPQH 249

Query: 733 PAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGSPQALG 792
           P   T   ++  G      +R   PP     R       S  TPP T  +   G P    
Sbjct: 250 PPSTTSQDQSTTGDGQEHTQRRKTPPATSNRRSPH----STATPPPTTKRQETGRPT--- 302

Query: 793 GPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQS 826
               P P TA  +      PP   P   ++ P +
Sbjct: 303 ----PRP-TATTQSGSS--PPHSSPPGVQANPTT 329


>gnl|CDD|111839 pfam02993, MCPVI, Minor capsid protein VI.  This minor capsid protein
            may act as a link between the external capsid and the
            internal DNA-protein core. The C-terminal 11 residues may
            function as a protease cofactor leading to enzyme
            activation.
          Length = 238

 Score = 36.7 bits (85), Expect = 0.012
 Identities = 21/119 (17%), Positives = 33/119 (27%), Gaps = 17/119 (14%)

Query: 1192 PPPPPPAEPPPTDLAHLPP---LPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSK 1248
                     P  +    P     P P  +  +   P     P   + +      P P  +
Sbjct: 108  KVLGEEEPAPQEETVADPIQALQPRPRPDVEEVLVPAAPEPPSYEETIKPG---PAPVEE 164

Query: 1249 KVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQP 1307
             V       P +        PV+ + PP P  P PV     +P  S       S  ++ 
Sbjct: 165  PVDSMAIAVPAIDT------PVTLELPPAPQPPPPV-----VPQPSTMVVHRRSRIKRT 212



 Score = 34.4 bits (79), Expect = 0.050
 Identities = 22/110 (20%), Positives = 28/110 (25%), Gaps = 7/110 (6%)

Query: 1228 PKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPP--VSPKPPPPPTAPKPVK 1285
                  +P P+ +    P     P P P   EV       PP       P P    +PV 
Sbjct: 108  KVLGEEEPAPQEETVADPIQALQPRPRPDVEEVLVPAAPEPPSYEETIKPGPAPVEEPVD 167

Query: 1286 AVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPA 1335
            ++A        P          P A   PP   P          S     
Sbjct: 168  SMAIAVPAIDTPVTLE-----LPPAPQPPPPVVPQPSTMVVHRRSRIKRT 212



 Score = 32.1 bits (73), Expect = 0.24
 Identities = 21/104 (20%), Positives = 32/104 (30%), Gaps = 5/104 (4%)

Query: 1243 PTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPS 1302
            P P  + V  P   + + +        + P  P PP+  + +K                 
Sbjct: 115  PAPQEETVADP-IQALQPRPRPDVEEVLVPAAPEPPSYEETIKPGPAPVEEPVDSMAIAV 173

Query: 1303 PARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAA 1346
            PA   P  L  PP   P     P   P P    +H  ++  R  
Sbjct: 174  PAIDTPVTLELPPAPQPP----PPVVPQPSTMVVHRRSRIKRTR 213



 Score = 31.3 bits (71), Expect = 0.52
 Identities = 20/103 (19%), Positives = 30/103 (29%)

Query: 1187 GPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPT 1246
            G  E  P       P   L   P     E       +PP   + +   P P  +   +  
Sbjct: 111  GEEEPAPQEETVADPIQALQPRPRPDVEEVLVPAAPEPPSYEETIKPGPAPVEEPVDSMA 170

Query: 1247 SKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAG 1289
                 +  P + E+  A   PPPV P+P       +       
Sbjct: 171  IAVPAIDTPVTLELPPAPQPPPPVVPQPSTMVVHRRSRIKRTR 213



 Score = 30.9 bits (70), Expect = 0.55
 Identities = 18/102 (17%), Positives = 29/102 (28%), Gaps = 4/102 (3%)

Query: 1275 PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAP 1334
            P P          A  P           PA   P +  +     P+    P    +   P
Sbjct: 115  PAPQEETVADPIQALQPRPRPDVEEVLVPAAPEPPSYEETIKPGPAPVEEPVDSMAIAVP 174

Query: 1335 ALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEET 1376
            A+  P           A    PP  P+ ++     R +++ T
Sbjct: 175  AIDTPV----TLELPPAPQPPPPVVPQPSTMVVHRRSRIKRT 212


>gnl|CDD|113693 pfam04929, Herpes_DNAp_acc, Herpes DNA replication accessory factor. 
            Replicative DNA polymerases are capable of polymerising
            tens of thousands of nucleotides without dissociating
            from their DNA templates. The high processivity of these
            polymerases is dependent upon accessory proteins that
            bind to the catalytic subunit of the polymerase or to the
            substrate. The Epstein-Barr virus (EBV) BMRF1 protein is
            an essential component of the viral DNA polymerase and is
            absolutely required for lytic virus replication. BMRF1 is
            also a transactivator. This family is predicted to have a
            UL42 like structure.
          Length = 395

 Score = 35.8 bits (83), Expect = 0.020
 Identities = 20/96 (20%), Positives = 28/96 (29%), Gaps = 3/96 (3%)

Query: 1224 PPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKP 1283
              V    VL         +             G     R+  +P P  P PP P + P P
Sbjct: 279  LDVDLSVVLLNASESADANAAEEGDTKSQQEVGP---SRSTVSPSPDPPSPPRPCSLPSP 335

Query: 1284 VKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPP 1319
              +V       +  +  PS    P A   + P  P 
Sbjct: 336  ADSVDEREPSLSSSTQDPSTETPPEAKPGESPKQPL 371



 Score = 30.8 bits (70), Expect = 0.71
 Identities = 20/85 (23%), Positives = 24/85 (28%), Gaps = 9/85 (10%)

Query: 1174 TGTVRRRPASEQAGPPELPPPPPPAEPPPTDLA--HLPPLP-------PPEGEARKPAKP 1224
            T + +    S     P   PP PP        A       P        P  E    AKP
Sbjct: 304  TKSQQEVGPSRSTVSPSPDPPSPPRPCSLPSPADSVDEREPSLSSSTQDPSTETPPEAKP 363

Query: 1225 PVSPKPVLTQPVPKLQGSPTPTSKK 1249
              SPK  L +   K +        K
Sbjct: 364  GESPKQPLKRKREKSKKKKKSKKLK 388


>gnl|CDD|112081 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein.  Tymoviruses
            are single stranded RNA viruses. This family includes a
            protein of unknown function that has been named based on
            its molecular weight. Tymoviruses such as the ononis
            yellow mosaic tymovirus encode only three proteins. Of
            these two are overlapping this protein overlaps a larger
            ORF that is thought to be the polymerase.
          Length = 465

 Score = 35.6 bits (82), Expect = 0.027
 Identities = 43/181 (23%), Positives = 54/181 (29%), Gaps = 13/181 (7%)

Query: 1194 PPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLP 1253
            P P   P       L P P      R P  PP  P    T P+  +   P P  +   LP
Sbjct: 227  PLPIPHPLRDQPGILGPSPLHTHPTRPPLPPPYRPAKSSTLPLSPILPRPRPDKRSGILP 286

Query: 1254 GPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPS------PARQP 1307
             P        H  PP        PP A + ++    L S                  +Q 
Sbjct: 287  NPRLRGTSTGHLPPPT----SQAPPRANERLQRSLHLHSSRPNSPHLRPRRIRKNSIQQT 342

Query: 1308 PAALAKPP--GTPPSLGASPAKPPSPGA-PALHVPAKPPRAAAAAAAAAAAPPAPPEGAS 1364
             A L      G  P+L  S   PP+    P    P  P +   AA A        P  + 
Sbjct: 343  RAQLGHSKSLGQSPNLRPSQRPPPTSRRLPLSPQPRSPYKVPTAALAPTRHLCFKPLLSL 402

Query: 1365 P 1365
            P
Sbjct: 403  P 403


>gnl|CDD|113864 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope
            glycoprotein (BLLF1).  This family consists of the BLLF1
            viral late glycoprotein, also termed gp350/220. It is the
            most abundantly expressed glycoprotein in the viral
            envelope of the Herpesviruses and is the major antigen
            responsible for stimulating the production of
            neutralising antibodies in vivo.
          Length = 830

 Score = 35.5 bits (81), Expect = 0.027
 Identities = 38/195 (19%), Positives = 51/195 (26%), Gaps = 15/195 (7%)

Query: 1182 ASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQG 1241
              E   P        P    PT     P    P  +         SP P++         
Sbjct: 482  LPEDTSPTSRTTSATPNATSPTPAVTTPNATSPTTQKTSDTPNATSPTPIVIGVTTTATS 541

Query: 1242 SPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPP------PPP----TAPKPVKAVAGLP 1291
             PT T+       P   E    + T  PV    P             T   P     G+P
Sbjct: 542  PPTGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSPTSQQPGIP 601

Query: 1292 SGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAA 1351
            S S     + S +  P    A P G       +P+ P +      HV    P       +
Sbjct: 602  SSSHSTPRSNSTSTTPLLTSAHPTGGENITEETPSVPSTT-----HVSTLSPGPGPGTTS 656

Query: 1352 AAAAPPAPPEGASPG 1366
              + P        PG
Sbjct: 657  QVSGPGNSSTSRYPG 671



 Score = 33.6 bits (76), Expect = 0.088
 Identities = 47/229 (20%), Positives = 69/229 (30%), Gaps = 19/229 (8%)

Query: 630 AIESPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRAT 689
               P    P   +      T       +  +  +     + G  +  P+S  P  P ++
Sbjct: 546 TTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSS-PTSQQPGIPSSS 604

Query: 690 TRQDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYL--LDEGPAPGTPPREARPGRH 747
                S       + +S    G       +P   S  ++  L  GP PGT  + + PG  
Sbjct: 605 HSTPRSNSTSTTPLLTSAHPTGGENITEETPSVPSTTHVSTLSPGPGPGTTSQVSGPGNS 664

Query: 748 GHSI-------------KRASVPPVPGKPRQVLPPGTSHFTPPQTPTKTRPGSP-QALGG 793
             S                A+ P  P   +  +P  TS      + TK   GS   A   
Sbjct: 665 STSRYPGEVHVTEGMPNPNATSPSAPSGQKTAVPTVTSTGGKANSTTKETSGSTLMASTS 724

Query: 794 PH--GPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPV 840
           PH    A  T     T  L P T   + PR    SP        +P P 
Sbjct: 725 PHTNEGAFRTTPYNATTYLPPSTSSKLRPRWTFTSPPVTTKQATVPVPP 773



 Score = 30.9 bits (69), Expect = 0.56
 Identities = 43/240 (17%), Positives = 59/240 (24%), Gaps = 29/240 (12%)

Query: 1151 RPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPP 1210
             P  ++    P    P  +    T T    P    + P    P      P       +  
Sbjct: 513  SPTTQKTSDTPNATSPTPIVIGVTTTATSPPTGTTSVPNATSPQVTEESPVNNTNTPVVT 572

Query: 1211 LPPPEG-EARKPAKPPVSPKPVLTQPVPKLQGSPTPTS----------KKVPLPGPGSPE 1259
              P     A    +      P   QP        TP S             P  G    E
Sbjct: 573  SAPSVLTSAVTTGQHGTGSSPTSQQPGIPSSSHSTPRSNSTSTTPLLTSAHPTGGENITE 632

Query: 1260 VKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSP-------------APSPARQ 1306
               +  +   VS   P P   P     V+G  + S    P             A SP+  
Sbjct: 633  ETPSVPSTTHVSTLSPGPG--PGTTSQVSGPGNSSTSRYPGEVHVTEGMPNPNATSPSAP 690

Query: 1307 PPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPP--RAAAAAAAAAAAPPAPPEGAS 1364
                 A P  T     A+     + G+  +     P     A       A    PP  +S
Sbjct: 691  SGQKTAVPTVTSTGGKANSTTKETSGSTLM-ASTSPHTNEGAFRTTPYNATTYLPPSTSS 749


>gnl|CDD|116083 pfam07462, MSP1_C, Merozoite surface protein 1 (MSP1) C-terminus.
            This family represents the C-terminal region of merozoite
            surface protein 1 (MSP1) which are found in a number of
            Plasmodium species. MSP-1 is a 200-kDa protein expressed
            on the surface of the P. vivax merozoite. MSP-1 of
            Plasmodium species is synthesised as a
            high-molecular-weight precursor and then processed into
            several fragments. At the time of red cell invasion by
            the merozoite, only the 19-kDa C-terminal fragment
            (MSP-119), which contains two epidermal growth
            factor-like domains, remains on the surface. Antibodies
            against MSP-119 inhibit merozoite entry into red cells,
            and immunisation with MSP-119 protects monkeys from
            challenging infections. Hence, MSP-119 is considered a
            promising vaccine candidate.
          Length = 574

 Score = 35.3 bits (81), Expect = 0.032
 Identities = 19/109 (17%), Positives = 34/109 (31%), Gaps = 29/109 (26%)

Query: 1276 PPPTAPKPVKAVAG----LPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSP 1331
             P   P+  +A+      LP G+   +            +  PP    +        PSP
Sbjct: 240  NPENNPEVNEALEQYKELLPKGTTQEAK--------VTTVVTPPQADAA--------PSP 283

Query: 1332 GAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACL 1380
             +          R A ++ +A+ +   P  G+  G  A     +    L
Sbjct: 284  LSV---------RPAGSSGSASGSTQIPTSGSVLGPGAAATELQQVVQL 323



 Score = 31.8 bits (72), Expect = 0.35
 Identities = 15/61 (24%), Positives = 16/61 (26%), Gaps = 7/61 (11%)

Query: 1275 PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAP 1334
            P   T    V  V   P        APSP    PA      G+       P      G  
Sbjct: 259  PKGTTQEAKVTTVVTPPQ----ADAAPSPLSVRPAGS---SGSASGSTQIPTSGSVLGPG 311

Query: 1335 A 1335
            A
Sbjct: 312  A 312


>gnl|CDD|118259 pfam09727, CortBP2, Cortactin-binding protein-2.  This entry is the
            first approximately 600 residues of cortactin-binding
            protein 2. In addition to being a positional candidate
            for autism this protein is expressed at highest levels in
            the brain in humans. Towards the C-terminal end of this
            entry are a series of proline-rich regions which are
            likely to be the points of interaction with the SH3
            domain of cortactin. The human protein has six associated
            ankyrin repeat domains pfam00023 towards the C-terminus
            which act as protein-protein interaction domains.
          Length = 463

 Score = 34.4 bits (79), Expect = 0.049
 Identities = 29/195 (14%), Positives = 58/195 (29%), Gaps = 18/195 (9%)

Query: 1097 RQRPRGPSKGEAGVEGPPLAKVEASATLKRRIRAKQNQQENVKFILTESDTVKRRPKAKE 1156
            R++  G  K    +E    ++ E     ++  +     +  +      ++    +    +
Sbjct: 232  REKLDGLEKMIQELERLNESEEELQLLRRKIAKGSVGNEGLM------AEVEALQKDVLD 285

Query: 1157 REAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEG 1216
             E   E    L +       ++ +   + +    L    P  +    +   L      EG
Sbjct: 286  MEGKDEEKTKLEMQCRP---LKPKLQRQASHGKLLGLEVPSLQKRMAEREKLENDSKQEG 342

Query: 1217 EARKPAKPPVSPKPVLTQPVPKLQG------SPTPTSKKVPLPGPGSPEVKRAHGTPPPV 1270
               +   P     P     V + Q         +  +  + L     P   R  G PPP+
Sbjct: 343  NQTQSP-PSREVSPTRDNLVAERQAVNQVTQELSRFTSPMALKTKSVPRELR--GNPPPL 399

Query: 1271 SPKPPPPPTAPKPVK 1285
             PK P     P P+ 
Sbjct: 400  PPKEPTLKEDPSPLH 414



 Score = 30.6 bits (69), Expect = 0.83
 Identities = 18/115 (15%), Positives = 32/115 (27%), Gaps = 14/115 (12%)

Query: 843 EVGPAAPG--PAPPPVPTAVPTLCLPPEADAEP-GRPKKRAHSLNRYAASDSEPERDELL 899
            + P           +   VP+L        +     K+  +      + +  P RD L 
Sbjct: 302 PLKPKLQRQASHGKLLGLEVPSLQKRMAEREKLENDSKQEGNQTQSPPSREVSPTRDNL- 360

Query: 900 VPAAAGPYATVQRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSS 954
                     V  R   +   +  +     +        R  +  PPP PPK  +
Sbjct: 361 ----------VAERQAVNQVTQELSRFTSPMALKTKSVPRELRGNPPPLPPKEPT 405


>gnl|CDD|115124 pfam06447, TraB_pillus, TraB pilus assembly protein.  This family
            consists of several bacterial TraB pilus assembly
            proteins. TraB is know to be essential for piliation and
            transfer but very little is known about its specific role
            in this process. It has been suggested that TraB extends
            into the periplasmic space and is anchored in the inner
            membrane via a single transmembrane segment near the N
            terminus. It is also thought that TraB may interact with
            TraP, in order to stabilise the proposed transmembrane
            complex formed by the tra operon products.
          Length = 407

 Score = 34.3 bits (79), Expect = 0.067
 Identities = 19/78 (24%), Positives = 26/78 (33%), Gaps = 8/78 (10%)

Query: 1285 KAVAGLPSGSAGPSPAPSPARQPPAALAKP-PGTPPSLGASPAKPPSPGAPALHVPAKPP 1343
             +     + +     +   A  PP  +A P PG P S+      PPSP  P+     K  
Sbjct: 114  SSSGEGLAPNTENVLSAQAAASPPVNIATPAPGGPSSVYGPNVPPPSPFDPSNGSSDK-- 171

Query: 1344 RAAAAAAAAAAAPPAPPE 1361
                 A  A    P  P 
Sbjct: 172  -----AQMAYQPVPVIPM 184


>gnl|CDD|111232 pfam02318, RPH3A_effector, Rabphilin-3A effector domain.  This is a
            family of proteins involved in protein transport in
            synaptic vesicles. Rabphilin-3A has been shown to contact
            Rab3A, a small G protein important in neurotransmitter
            release, in two distinct areas.
          Length = 275

 Score = 33.8 bits (77), Expect = 0.086
 Identities = 22/87 (25%), Positives = 30/87 (34%), Gaps = 11/87 (12%)

Query: 1250 VPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPA 1309
            +P P P  P+        P  + +P P  ++     A      G       P  A  P  
Sbjct: 164  LPQPMPQRPDDPLQPYYVPVTTNQPLPNASSAARTPA-----RGDMEDRRTPGGAPGP-- 216

Query: 1310 ALAKPPGT----PPSLGASPAKPPSPG 1332
                 PGT      +  ASPA+  SPG
Sbjct: 217  QPMTMPGTSSCQMTTPRASPARCNSPG 243



 Score = 30.8 bits (69), Expect = 0.62
 Identities = 26/114 (22%), Positives = 32/114 (28%), Gaps = 2/114 (1%)

Query: 1228 PKPVLTQPVPKLQGSP-TPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKA 1286
            PK VL QP+P+    P  P    V    P       A             P  AP P   
Sbjct: 160  PKFVLPQPMPQRPDDPLQPYYVPVTTNQPLPNASSAARTPARGDMEDRRTPGGAPGPQPM 219

Query: 1287 VAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPA 1340
                 S     +P  SPAR   +   +  G     G +    P P         
Sbjct: 220  TMPGTSSCQMTTPRASPAR-CNSPGLQSNGDHGHGGGAGPTSPLPNGEQGTRRN 272


>gnl|CDD|114370 pfam05642, Sporozoite_P67, Sporozoite P67 surface antigen.  This
           family consists of several Theileria P67 surface
           antigens. A stage specific surface antigen of Theileria
           parva, p67, is the basis for the development of an
           anti-sporozoite vaccine for the control of East Coast
           fever (ECF) in cattle. The antigen has been shown to
           contain five distinct linear peptide sequences
           recognised by sporozoite-neutralising murine monoclonal
           antibodies.
          Length = 687

 Score = 33.8 bits (77), Expect = 0.087
 Identities = 33/171 (19%), Positives = 48/171 (28%), Gaps = 24/171 (14%)

Query: 654 DSELSDELQAAMTGPAEVGPTTEKP------SSHLPPTPRATTRQDSSLGGRARH--MSS 705
            SE  +E   + +     G    +P       S    T  +T +  + LG    H   ++
Sbjct: 120 GSESEEEDNKSTSSKDGKGSKKTQPPVSTSSGSTTSQTDLSTAQSQNGLGSSGSHDQETA 179

Query: 706 SQELLGDGPPGPSSPMSRSQEYLLDEGPAPGT---------PPREARPGRHGHSIKRASV 756
            Q+           P        +     PG              +R G+  H   R   
Sbjct: 180 QQDPAVSQSGVVGVPGVGVGGVGVPGVGVPGAGGLPGVGVGRAGTSREGQGQHHQVRDGD 239

Query: 757 PPVPGKPRQVLPPGTSHFT---PPQTPTKTRPGSPQALGGP----HGPAPA 800
             V  KP     P  S  T      T T T   S  A+        GP P+
Sbjct: 240 GRVIEKPGLPGDPAASTSTTTPSSSTSTTTPSSSSNAVTRHTDSISGPIPS 290


>gnl|CDD|115339 pfam06676, DUF1178, Protein of unknown function (DUF1178).  This
            family consists of several hypothetical bacterial
            proteins of around 150 residues in length. The function
            of this family is unknown.
          Length = 165

 Score = 33.5 bits (77), Expect = 0.11
 Identities = 19/63 (30%), Positives = 24/63 (38%)

Query: 1331 PGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEK 1390
              AP ++       A AA AAA AA P     A         L    A L AAL A+   
Sbjct: 47   LMAPRVNAKGNQLAAPAAPAAAPAAAPRAAVAAPAAPGPAPALMAQEAALQAALAALRRH 106

Query: 1391 IRQ 1393
            + +
Sbjct: 107  VVK 109


>gnl|CDD|117155 pfam08580, KAR9, Yeast cortical protein KAR9.  The KAR9 protein in
            Saccharomyces cerevisiae is a cytoskeletal protein
            required for karyogamy, correct positioning of the
            mitotic spindle and for orientation of cytoplasmic
            microtubules. KAR9 localises at the shmoo tip in mating
            cells and at the tip of the growing bud in anaphase.
          Length = 668

 Score = 33.0 bits (75), Expect = 0.13
 Identities = 29/183 (15%), Positives = 38/183 (20%), Gaps = 18/183 (9%)

Query: 1157 REAGPEPPPPLSVYHNGTGTVRR---RPASEQAGPPELPP-----PPPPAEPPPTDLAHL 1208
              +     P       G   +RR   +P          P            P  + L   
Sbjct: 417  VSSRRVGTPGSKSDRVGAVLLRRMNIKPTLASIPTERKPSNISVFEDSSTSPNSSTLLRD 476

Query: 1209 PPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPP 1268
            PP      E+      P   K      V         T        P S    R      
Sbjct: 477  PPPKKCGEESGHLPNNPFFNKTTKKSDVDTSHKYKPVTPSPASSLSPCSLT--RYGSQIG 534

Query: 1269 PVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKP 1328
            P S K      +         +P  S   S    P    PA+            +     
Sbjct: 535  PTSTKKLKLTLSS--------IPPLSPRQSIITLPTPSRPASRISSLSLRLGSYSGSIVS 586

Query: 1329 PSP 1331
            P P
Sbjct: 587  PPP 589



 Score = 31.4 bits (71), Expect = 0.45
 Identities = 38/198 (19%), Positives = 64/198 (32%), Gaps = 14/198 (7%)

Query: 620 RKAPQSLEVM-AIESPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTG-PAEVGPTTEK 677
             +P S  +M   +S P    +     +P   +     +   L   M   P      TE+
Sbjct: 397 SSSPSSSVIMTPPDSGPGSNVSSRRVGTPGSKS---DRVGAVLLRRMNIKPTLASIPTER 453

Query: 678 PSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPS-SPMSRSQEYLLDEGPAPG 736
             S++     ++T  +SS   R        E  G  P  P  +  ++  +        P 
Sbjct: 454 KPSNISVFEDSSTSPNSSTLLRDPPPKKCGEESGHLPNNPFFNKTTKKSDVDTSHKYKPV 513

Query: 737 TP-----PREARPGRHGHSIKRASVPPVPGKP-RQVLPPGTSHFTPPQTPTKTRPGSPQA 790
           TP            R+G  I   S      K     +PP +   +    PT +RP S  +
Sbjct: 514 TPSPASSLSPCSLTRYGSQIGPTS--TKKLKLTLSSIPPLSPRQSIITLPTPSRPASRIS 571

Query: 791 LGGPHGPAPATAKVKPTP 808
                  + + + V P P
Sbjct: 572 SLSLRLGSYSGSIVSPPP 589


>gnl|CDD|110230 pfam01213, CAP_N, Adenylate cyclase associated (CAP) N terminal. 
          Length = 313

 Score = 32.9 bits (75), Expect = 0.14
 Identities = 12/34 (35%), Positives = 15/34 (44%)

Query: 1263 AHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAG 1296
            +     P  P PPPPP+ P    +V    S S G
Sbjct: 227  SSAPGAPPPPPPPPPPSVPTISNSVESASSDSKG 260


>gnl|CDD|115396 pfam06735, DUF1210, Protein of unknown function (DUF1210).  This
            family represents a conserved region within plant
            proline-rich proteins.
          Length = 196

 Score = 32.9 bits (75), Expect = 0.14
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 1188 PPELPPPPPPAEPPPTDLAHLPPLP--PPEGEARKPAKPPVSPKPVLTQPVPKLQGSP 1243
            PP+LPP PPP   PP     +PP+P   P     KP  P   P PV  +P P  +  P
Sbjct: 139  PPKLPPFPPPKPCPPIYKPPVPPVPIYKPPVPKYKPPPPKPPPPPVYKKPCPPKKPPP 196



 Score = 32.9 bits (75), Expect = 0.16
 Identities = 29/90 (32%), Positives = 33/90 (36%), Gaps = 16/90 (17%)

Query: 1196 PPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTS--KKVPLP 1253
             P +    D  H  P+PPP      P  PP  P      P P +   P P     K P+P
Sbjct: 121  GPFKKKFFDHFHKKPVPPP------PKLPPFPPPK----PCPPIYKPPVPPVPIYKPPVP 170

Query: 1254 GPGSPEVKRAHGTPPPVSPKPPPPPTAPKP 1283
                P  K     PPP   K P PP  P P
Sbjct: 171  KYKPPPPK----PPPPPVYKKPCPPKKPPP 196



 Score = 32.9 bits (75), Expect = 0.17
 Identities = 24/71 (33%), Positives = 26/71 (36%), Gaps = 3/71 (4%)

Query: 1261 KRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPS 1320
               H  P P  PK PP P  PKP   +   P         P P  +PP    KPP  P  
Sbjct: 129  DHFHKKPVPPPPKLPPFP-PPKPCPPIYKPPVPPVPIYKPPVPKYKPPP--PKPPPPPVY 185

Query: 1321 LGASPAKPPSP 1331
                P K P P
Sbjct: 186  KKPCPPKKPPP 196



 Score = 32.1 bits (73), Expect = 0.26
 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 2/64 (3%)

Query: 1188 PPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTS 1247
            P   PP  PP  PP        P  PP    + P      P P    P P +   P P  
Sbjct: 135  PVPPPPKLPPFPPPKPCPPIYKPPVPPVPIYKPPVPKYKPPPP--KPPPPPVYKKPCPPK 192

Query: 1248 KKVP 1251
            K  P
Sbjct: 193  KPPP 196


>gnl|CDD|116036 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein
            (LMP2) protein.  This family consists of several
            Gammaherpesvirus latent membrane protein (LMP2) proteins.
            Epstein-Barr virus is a human Gammaherpesvirus that
            infects and establishes latency in B lymphocytes in vivo.
            The latent membrane protein 2 (LMP2) gene is expressed in
            latently infected B cells and encodes two protein
            isoforms, LMP2A and LMP2B, that are identical except for
            an additional N-terminal 119 aa cytoplasmic domain which
            is present in the LMP2A isoform. LMP2A is thought to play
            a key role in either the establishment or the maintenance
            of latency and/or the reactivation of productive
            infection from the latent state. The significance of
            LMP2B and its role in pathogenesis remain unclear.
          Length = 489

 Score = 32.5 bits (74), Expect = 0.20
 Identities = 23/114 (20%), Positives = 29/114 (25%), Gaps = 22/114 (19%)

Query: 1160 GPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEAR 1219
            G   P          G       S      + P PP P +         PP     G+  
Sbjct: 10   GAGGPRSHGGPDGDEGDSNPYYPSSFGSSWDRPGPPVPEDYDAPS-HRPPPYGGSNGDRH 68

Query: 1220 KPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPK 1273
               +P     P L      L  +           G G P        PPP SP+
Sbjct: 69   GGYQPLGQQDPSL---YAGLGQN----------GGGGLP--------PPPYSPR 101


>gnl|CDD|115896 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32.  This family consists
            of several Mycoplasma species specific Cytadhesin P32 and
            P30 proteins. P30 has been found to be membrane
            associated and localised on the tip organelle. It is
            thought that it is important in cytadherence and
            virulence.
          Length = 274

 Score = 32.6 bits (74), Expect = 0.21
 Identities = 31/138 (22%), Positives = 45/138 (32%), Gaps = 10/138 (7%)

Query: 1203 TDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKR 1262
            T           E            P+  + QP    Q  P P  +    P    P++  
Sbjct: 123  TQAIETEEQNTQEPTQPAGVNVANQPQMGINQPQINPQFGPNPQQRPGFNPQCFQPQMGM 182

Query: 1263 AHGTPPPVSPKPP---PPPTAPKPVKAVAGLPSGSAGPSPAPS---PARQPPAALAKPPG 1316
              G PP +   PP     P   +P   + G+P     P+  P+   P  +P      PPG
Sbjct: 183  RPGMPPQMGGMPPNMGMRPGFNQP--QMGGMPPRPNFPNMMPNMNRPGFRPQPGGGVPPG 240

Query: 1317 TP--PSLGASPAKPPSPG 1332
                P +G  P   P+ G
Sbjct: 241  NFNHPGMGPRPGFFPNQG 258


>gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N terminal region.  The defective
            chorion-1 gene (dec-1) in Drosophila encodes follicle
            cell proteins necessary for proper eggshell assembly.
            Multiple products of the dec-1 gene are formed by
            alternative RNA splicing and proteolytic processing.
            Cleavage products include S80 (80 kDa) which is
            incorporated into the eggshell, and further proteolysis
            of S80 gives S60 (60 kDa).
          Length = 407

 Score = 32.5 bits (73), Expect = 0.21
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 1275 PPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAP 1334
            P  P+ P  + A A +P+      PAP+PA  PPAA A    TP +      +P   G  
Sbjct: 94   PAMPSMPGLLGAAAPVPA------PAPAPAAAPPAAPAPAADTPAAPIPDAVQPAILGQA 147

Query: 1335 ALH 1337
            AL 
Sbjct: 148  ALQ 150



 Score = 30.5 bits (68), Expect = 0.82
 Identities = 20/51 (39%), Positives = 21/51 (41%)

Query: 1321 LGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQ 1371
            L   PA P  PG      P   P  A AAA  AA  PA    A+P   A Q
Sbjct: 90   LAQLPAMPSMPGLLGAAAPVPAPAPAPAAAPPAAPAPAADTPAAPIPDAVQ 140


>gnl|CDD|113316 pfam04540, Herpes_UL51, Herpesvirus UL51 protein.  UL51 protein is a
            virion protein. In pseudorabies virus, UL51 was
            identified as a component of the capsid. In herpes
            simplex virus type 1 there is evidence for
            post-translational modification of UL51.
          Length = 239

 Score = 32.4 bits (74), Expect = 0.25
 Identities = 17/75 (22%), Positives = 22/75 (29%), Gaps = 2/75 (2%)

Query: 1286 AVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPG-APALHVPAKPPR 1344
            +   L +G+   +        PP  L  PP     +   P KP  P   P L     P R
Sbjct: 166  STRALAAGTGVLNLLRMGLVPPPD-LKDPPALVEVIDVLPEKPLPPDPVPPLKPTNPPMR 224

Query: 1345 AAAAAAAAAAAPPAP 1359
                A        A 
Sbjct: 225  RTPPAKRRKTLVAAK 239


>gnl|CDD|115030 pfam06346, Drf_FH1, Formin Homology Region 1.  This region is found
            in some of the Diaphanous related formins (Drfs). It
            consists of low complexity repeats of around 12 residues.
          Length = 159

 Score = 32.2 bits (73), Expect = 0.26
 Identities = 44/161 (27%), Positives = 52/161 (32%), Gaps = 6/161 (3%)

Query: 1200 PPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPE 1259
            PPP     +PP PP       P  PP+     +  P       P P    +P P P    
Sbjct: 3    PPPLPGGGIPPPPPLPPGVGIPPPPPLPGGTGIPPP------PPLPGGAAIPPPPPLPGV 56

Query: 1260 VKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPP 1319
                   P P +   PPPP  P         P       P P P     AA+  PP  P 
Sbjct: 57   AGIPPPPPLPGATAIPPPPPLPGAAGIPPPPPLPGGAGIPPPPPPLPGGAAVPPPPPLPG 116

Query: 1320 SLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPP 1360
              G  P  PP PGAP +  P     +          P AP 
Sbjct: 117  GPGVPPPPPPFPGAPGIPPPPPGMGSPPPPPFGFGVPAAPV 157


>gnl|CDD|113801 pfam05044, Prox1, Homeobox prospero-like protein (PROX1).  The
            homeobox gene Prox1 is expressed in a subpopulation of
            endothelial cells that, after budding from veins, gives
            rise to the mammalian lymphatic system. Prox1 has been
            found to be an early specific marker for the developing
            liver and pancreas in the mammalian foregut endoderm.
            This family contains an atypical homeobox domain.
          Length = 741

 Score = 32.3 bits (73), Expect = 0.26
 Identities = 45/220 (20%), Positives = 69/220 (31%), Gaps = 9/220 (4%)

Query: 1086 DPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEASATLKRRIR--AKQNQQENVKFILT 1143
            DPGPF++      R    +  +   +     K   S+ ++   +  A+  +QE    +  
Sbjct: 304  DPGPFLDRARALIREHNMASNKPKRDSNNKNKNNNSSMMRTEGKGLAEVLKQELNTAMSQ 363

Query: 1144 ESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPT 1203
              DTV +    + R   P+  PPL             P    A    L        P P 
Sbjct: 364  VVDTVVKVFVHQPRRQLPQVFPPLKSPRTRFAQNGETPNFHTANQ-RLQCFGDVIIPNPL 422

Query: 1204 DLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEVKRA 1263
            D A       P+   +  A P V     + +   + Q S          P      +   
Sbjct: 423  DTAQ-SSQQTPQSLDQTEALPLV-----VRKNSSEQQASQQQQGSHHTEPSLHQSPLSST 476

Query: 1264 HGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSP 1303
             G   P    P P P    P ++  G P GS     + SP
Sbjct: 477  AGFATPSFRHPFPLPLMAYPFQSPLGAPIGSLFGKDSSSP 516


>gnl|CDD|118680 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein
            (DUF2360).  This is the conserved 140 amino acid region
            of a family of proteins conserved from nematodes to
            humans. One Caenorhabditis elegans member is annotated as
            a Daf-16-dependent longevity protein 1 but this could not
            be confirmed. The function is unknown.
          Length = 141

 Score = 32.3 bits (74), Expect = 0.26
 Identities = 21/63 (33%), Positives = 25/63 (39%), Gaps = 4/63 (6%)

Query: 1286 AVAGLPSG--SAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVP--AK 1341
            ++ GL      A P   P PA    +A   P   PP    SP  P  P  PA +    AK
Sbjct: 46   SIPGLEDVTVEANPPSVPGPAEPAQSAPPPPQPPPPPPENSPEPPSEPPEPAENGVTVAK 105

Query: 1342 PPR 1344
             PR
Sbjct: 106  DPR 108



 Score = 31.2 bits (71), Expect = 0.55
 Identities = 20/76 (26%), Positives = 24/76 (31%), Gaps = 4/76 (5%)

Query: 1171 HNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKP 1230
             + T           A P +  PPPP   PPP       P PP E          V+  P
Sbjct: 51   EDVTVEANPPSVPGPAEPAQSAPPPPQPPPPPP---ENSPEPPSEPPEPAENGVTVAKDP 107

Query: 1231 VLTQPVPKLQ-GSPTP 1245
               +    LQ G P  
Sbjct: 108  RYAKYFKMLQVGVPEQ 123



 Score = 31.2 bits (71), Expect = 0.58
 Identities = 17/71 (23%), Positives = 20/71 (28%), Gaps = 6/71 (8%)

Query: 1238 KLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGP 1297
            KL   P      V    P  P       + PP    PPPPP            PS    P
Sbjct: 43   KLASIPGLEDVTVEANPPSVPGPAEPAQSAPPPPQPPPPPPENSPEP------PSEPPEP 96

Query: 1298 SPAPSPARQPP 1308
            +       + P
Sbjct: 97   AENGVTVAKDP 107


>gnl|CDD|118949 pfam10428, SOG2, RAM signalling pathway protein.  SOG2 proteins in
            Saccharomyces cerevisiae are involved in cell separation
            and cytokinesis.
          Length = 434

 Score = 31.7 bits (72), Expect = 0.34
 Identities = 38/171 (22%), Positives = 49/171 (28%), Gaps = 19/171 (11%)

Query: 1241 GSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPA 1300
            G+P P  K  P   P   E++R        S  P  P         V  L SG+    P 
Sbjct: 150  GAPLPDRKMRPSIKPPISEIERPSARSSTRSSSPLSPTRGRDRPGGVRRLRSGTTIQHPG 209

Query: 1301 PSPAR---QPPAALAKPPGTPPSLGASPAKPPSP---------GAPALHVPAKPPRAAAA 1348
            P       Q       P  TP   G S                  P+  +PA P    + 
Sbjct: 210  PLAKSANIQVATDSPGPVSTPYRNGRSSQARSRSSSSSNSSNTSTPSSLLPATPRSGESF 269

Query: 1349 AAAAAAAPPA--PPEGASPGDSARQKLEET----SACLAAALQAVEEKIRQ 1393
                 +  P   P  G    +  R   E      +    A LQA+   I Q
Sbjct: 270  PPLPTSVSPRINPNTGLDEIEEDRI-FERIFLSLTKAYTAVLQALPSAISQ 319


>gnl|CDD|118379 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria
            (DUF2076).  This domain, found in various hypothetical
            prokaryotic proteins, has no known function. The domain,
            however, is found in various periplasmic ligand-binding
            sensor proteins.
          Length = 236

 Score = 31.9 bits (73), Expect = 0.34
 Identities = 24/69 (34%), Positives = 26/69 (37%), Gaps = 11/69 (15%)

Query: 1293 GSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRA------A 1346
            GS    P P PA QPP    +  G P    A P + P PGA     PA           A
Sbjct: 90   GSPPRPPPPQPAPQPPQPGWREQGYPG--QAQPQQQPGPGAGQ---PAGNGGGGSFLGGA 144

Query: 1347 AAAAAAAAA 1355
            A  AA  A 
Sbjct: 145  AQTAAGVAG 153


>gnl|CDD|118323 pfam09792, But2, Ubiquitin 3 binding protein But2.  This family is of
            proteins conserved in yeasts. It binds to Uba3 and is
            involved in the NEDD8 signalling pathway.
          Length = 376

 Score = 31.5 bits (71), Expect = 0.40
 Identities = 24/103 (23%), Positives = 33/103 (32%), Gaps = 7/103 (6%)

Query: 1272 PKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSP 1331
            P    P      + AVA  PS S+  +     +++  A+      T     ASP      
Sbjct: 134  PGNGNPKCVGIALSAVAPQPSKSSSGTHRTDLSQRKSAS--NFMPTQRCGKASPLSRYYA 191

Query: 1332 GAPALHVPAKPPRAAAAAAAAAAAP-----PAPPEGASPGDSA 1369
                  V   P  AA+   AA+        P  P G    DS 
Sbjct: 192  YTTKCSVVPVPRNAASDIPAASPTDSNAVYPLFPHGIRLIDST 234


>gnl|CDD|110072 pfam01044, Vinculin, Vinculin family. 
          Length = 850

 Score = 31.6 bits (72), Expect = 0.40
 Identities = 18/73 (24%), Positives = 24/73 (32%), Gaps = 4/73 (5%)

Query: 1129 RAKQNQQENVKFILTES----DTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASE 1184
             A ++ +EN    L       D V+   +A      P   P  S +         RP   
Sbjct: 582  GAAKSWEENNYEFLDAVRLVYDAVRPIRQAVLMNRSPPELPTDSEFEREDEPADPRPPPP 641

Query: 1185 QAGPPELPPPPPP 1197
                P   PPPPP
Sbjct: 642  VETEPPPRPPPPP 654


>gnl|CDD|112154 pfam03326, Herpes_TAF50, Herpesvirus transcription activation
           factor (transactivator).  This family includes EBV BRLF1
           and similar ORF 50 proteins from other herpesviruses.
          Length = 500

 Score = 31.7 bits (72), Expect = 0.42
 Identities = 51/246 (20%), Positives = 75/246 (30%), Gaps = 19/246 (7%)

Query: 632 ESPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRATTR 691
             P  P+P      SP     Q SE       +   PA    +  + +S  P  P + + 
Sbjct: 218 PHPSLPQPQSPLKPSPSSARPQQSE-----SFSDVWPAST-QSPREETSAEPLAPASPSS 271

Query: 692 QDSSLGGRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHSI 751
           +  S     +   SS +   +       P S          P+   P     P       
Sbjct: 272 RRPSTAQEEQIACSSPQAEPEQGVQSYVPQSSDSRPSCFPAPSTTQPTF--LPPNTNKKA 329

Query: 752 KRASVP-PVPGKPRQVLPPGTSHFTPPQTPTKTRP-GSPQALGG------PHGPAPATAK 803
           KR   P  V  K         +H        + RP GS Q+              P+ A 
Sbjct: 330 KRDRRPQMVTPKQEGGAAVSQNHDGGTVRAPRGRPSGSGQSPPSNSPLLSSLADTPSGAA 389

Query: 804 VKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPAAPGPAPPPVPTAVPTL 863
            +P   L P   +     +  + P   G + V PQP E E+GP+    A       +  L
Sbjct: 390 HQPASLLPPAVVQQQLEDASDKQPPTPGSSLV-PQPDEQELGPS--VMALLDRDQGILAL 446

Query: 864 CLPPEA 869
            L P  
Sbjct: 447 ILAPIP 452


>gnl|CDD|118043 pfam09507, CDC27, DNA polymerase subunit Cdc27.  This protein forms
            the C subunit of DNA polymerase delta. It carries the
            essential residues for binding to the Pol1 subunit of
            polymerase alpha, from residues 293-332, which are
            characterised by the motif D-G-VT, referred to as the
            DPIM motif. The first 160 residues of the protein form
            the minimal domain for binding to the B subunit, Cdc1, of
            polymerase delta, the final 10 C-terminal residues,
            362-372, being the DNA sliding clamp, PCNA, binding
            motif.
          Length = 406

 Score = 31.4 bits (71), Expect = 0.44
 Identities = 31/144 (21%), Positives = 37/144 (25%), Gaps = 13/144 (9%)

Query: 1177 VRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPV 1236
            V         GPP   P  P  +P   +            ++ KP K         T   
Sbjct: 131  VPVESGQRAHGPPAKKPSAPVKKPKGIEPMKASKAASKTQKSTKPTKKE-------TIAP 183

Query: 1237 PKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAG 1296
                 S   +SKK       S   K A   P P    P P     K  K V G       
Sbjct: 184  SAKTASSKASSKK---ENLMSNFFKAA---PKPKKKSPLPSEEEKKERKRVEGEDLSDDE 237

Query: 1297 PSPAPSPARQPPAALAKPPGTPPS 1320
                  P +   A    P  T  S
Sbjct: 238  EEDEDEPLKPKEAKPTSPQKTRKS 261



 Score = 31.4 bits (71), Expect = 0.50
 Identities = 20/109 (18%), Positives = 29/109 (26%), Gaps = 8/109 (7%)

Query: 1305 RQPPAALAKPPGTPPSLGASPAKPP--------SPGAPALHVPAKPPRAAAAAAAAAAAP 1356
            R P  +  +  G P    ++P K P        S  A       KP +    A +A  A 
Sbjct: 130  RVPVESGQRAHGPPAKKPSAPVKKPKGIEPMKASKAASKTQKSTKPTKKETIAPSAKTAS 189

Query: 1357 PAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQEDAQGPRDSAAE 1405
                       S   K        +      E+K R+           E
Sbjct: 190  SKASSKKENLMSNFFKAAPKPKKKSPLPSEEEKKERKRVEGEDLSDDEE 238


>gnl|CDD|118020 pfam09483, HpaP, Type III secretion protein (HpaP).  This entry
            represents proteins encoded by genes which are always
            found in type III secretion operons, although their
            function in the processes of secretion and virulence is
            unclear. Hpa stands for Hrp-associated gene, where Hrp
            stands for hypersensitivity response and virulence.
          Length = 189

 Score = 31.3 bits (71), Expect = 0.44
 Identities = 21/80 (26%), Positives = 25/80 (31%), Gaps = 7/80 (8%)

Query: 1295 AGPSPAPSPARQPPAALAK----PPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAA 1350
            A  +PAP  AR+    L +     P   P     P       A A               
Sbjct: 1    APGAPAPRAARRSFDQLMRRLRSAPAALPDTVPPPRGDGERPADA---AMPWFDETRDGP 57

Query: 1351 AAAAAPPAPPEGASPGDSAR 1370
             A A P AP + AS    AR
Sbjct: 58   PAEADPAAPRDAASREPMAR 77



 Score = 30.5 bits (69), Expect = 0.92
 Identities = 21/96 (21%), Positives = 25/96 (26%), Gaps = 4/96 (4%)

Query: 1263 AHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLG 1322
            A G P P + +        +   A A LP     P                     P   
Sbjct: 1    APGAPAPRAARRSFDQLMRRLRSAPAALPDTVPPPRGDGERPADAAMPWFDETRDGPPAE 60

Query: 1323 ASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPA 1358
            A PA P    +          R A A  A  AA  A
Sbjct: 61   ADPAAPRDAASR----EPMARRDAGAVGAFVAARFA 92


>gnl|CDD|117962 pfam09422, WTX, WTX protein.  The WTX protein is found to be
            inactivated in one third of Wilms tumours. The WTX
            protein is functionally uncharacterised.
          Length = 417

 Score = 31.4 bits (71), Expect = 0.49
 Identities = 26/124 (20%), Positives = 37/124 (29%), Gaps = 18/124 (14%)

Query: 1153 KAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLP 1212
            +AK  E G   P  L+           +       P +  P  P A PPP + + L    
Sbjct: 107  EAKAPEGGLILPSSLTASLECVKEETPKNLRPPDTPGQDGPRDPAAFPPPGEGSGLDSAC 166

Query: 1213 PPEGEARKPAKPPVSPKPVLTQPVPKLQ------------------GSPTPTSKKVPLPG 1254
            P       P+ P      +L + V  L+                  G  +   K V    
Sbjct: 167  PDPSTVDPPSDPSFDRCSLLFEDVTSLKSFDSLTGCGDIIADQDDEGGSSLCDKPVSGRQ 226

Query: 1255 PGSP 1258
            PG P
Sbjct: 227  PGKP 230


>gnl|CDD|114503 pfam05781, MRVI1, MRVI1 protein.  This family consists of mammalian
            MRVI1 proteins which are related to the
            lymphoid-restricted membrane protein (JAW1) and the IP3
            receptor associated cGMP kinase substrates A and B (IRAGA
            and IRAGB). The function of MRVI1 is unknown although
            mutations in the Mrvi1 gene induces myeloid leukaemia by
            altering the expression of a gene important for myeloid
            cell growth and/or differentiation so it has been
            speculated that Mrvi1 is a tumour suppressor gene. IRAG
            is very similar in sequence to MRVI1 and is an essential
            NO/cGKI-dependent regulator of IP3-induced calcium
            release. Activation of cGKI decreases IP3-stimulated
            elevations in intracellular calcium, induces smooth
            muscle relaxation and contributes to the
            antiproliferative and pro-apoptotic effects of NO/cGMP.
            Jaw1 is a member of a class of proteins with
            COOH-terminal hydrophobic membrane anchors and is
            structurally similar to proteins involved in vesicle
            targeting and fusion. This suggests that the function
            and/or the structure of the ER in lymphocytes may be
            modified by lymphoid-restricted resident ER proteins.
          Length = 538

 Score = 31.1 bits (70), Expect = 0.56
 Identities = 32/156 (20%), Positives = 48/156 (30%), Gaps = 18/156 (11%)

Query: 1251 PLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAA 1310
            P PG G+ +V R    P P     P  P            P  S G +    PA +    
Sbjct: 2    PEPGDGALDVGRPLACPAPTGNPLPGGPLQ----GCGRMNPDASQGENGVGEPAGESVGQ 57

Query: 1311 LAK---PPGTPPSLG--ASPAKPPSPGAPALHVPAKPPRA-------AAAAAAAAAAPPA 1358
              +   P  +PP L   +S +   +       + A                +  AA+P  
Sbjct: 58   KRELWPPTSSPPLLRGTSSDSGTETSSPRGQKILAMASLDLDEKRLCGKEESKRAASPGL 117

Query: 1359 PPEGASPGDSARQKLEETSACLAAALQAVEEKIRQE 1394
              +G S  +     L   S  +   L  +E    QE
Sbjct: 118  KQQGTSLAEEH--ILLRNSNLVGKKLPELEAAEEQE 151


>gnl|CDD|111297 pfam02389, Cornifin, Cornifin (SPRR) family.  SPRR genes (formerly
            SPR) encode a novel class of polypeptides (small proline
            rich proteins) that are strongly induced during
            differentiation of human epidermal keratinocytes in vitro
            and in vivo.The most characteristic feature of the SPRR
            gene family resides in the structure of the central
            segments of the encoded polypeptides that are built up
            from tandemly repeated units of either eight (SPRR1 and
            SPRR3) or nine (SPRR2) amino acids with the general
            consensus XKXPEPXX where X is any amino acid.
          Length = 167

 Score = 31.0 bits (69), Expect = 0.60
 Identities = 34/145 (23%), Positives = 42/145 (28%)

Query: 1176 TVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQP 1235
            T   +P  +Q   P  PPP  P  P   +  H     P   +  +P    V        P
Sbjct: 11   TPPPQPQQQQVKQPCQPPPQEPFVPKTKEPCHPDVPQPGNTKIPEPGCTKVPEPGYTKVP 70

Query: 1236 VPKLQGSPTPTSKKVPLPGPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSA 1295
             P     P P    VP PG            P P   K P P +   P      +P    
Sbjct: 71   GPGSTKVPEPGCTTVPEPGYTKVPEPGCTKVPEPGYTKVPEPGSTKVPDPGCPKVPEPCQ 130

Query: 1296 GPSPAPSPARQPPAALAKPPGTPPS 1320
               P     + P     K P   PS
Sbjct: 131  PKVPEQGYPKVPEPGYTKVPEPCPS 155


>gnl|CDD|111365 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein.  This
            protein is covalently attached to the terminii of
            replicating DNA in vivo.
          Length = 548

 Score = 30.8 bits (70), Expect = 0.66
 Identities = 12/41 (29%), Positives = 13/41 (31%), Gaps = 12/41 (29%)

Query: 1178 RRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPLPPPEGEA 1218
            RRR       PP  PP P   E           +P  E E 
Sbjct: 294  RRRR------PPPSPPEPEEEEEEE------EEVPEEEEEE 322


>gnl|CDD|114344 pfam05616, Neisseria_TspB, Neisseria meningitidis TspB protein.  This
            family consists of several Neisseria meningitidis TspB
            virulence factor proteins.
          Length = 508

 Score = 30.8 bits (69), Expect = 0.68
 Identities = 28/97 (28%), Positives = 35/97 (36%), Gaps = 14/97 (14%)

Query: 1240 QGSPTPTSKKVPLPG--PGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGP 1297
            QG+ T   + +P P   PGS E   A   P  VSP   P           A  P+ +  P
Sbjct: 306  QGNTTVDVQVIPRPDLTPGSAEAPNAQPLPE-VSPAENP-----------ANNPNPNENP 353

Query: 1298 SPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGAP 1334
              +P+P   P       P T    G  P  P  P  P
Sbjct: 354  GTSPNPEPDPDLNPDANPDTDGQPGTRPDSPAVPDRP 390


>gnl|CDD|114128 pfam05387, Chorion_3, Chorion family 3.  This family consists of
            several Drosophila chorion proteins S36 and S38. The
            chorion genes of Drosophila are amplified in response to
            developmental signals in the follicle cells of the ovary.
          Length = 321

 Score = 30.6 bits (68), Expect = 0.74
 Identities = 45/167 (26%), Positives = 59/167 (35%), Gaps = 9/167 (5%)

Query: 1199 EPPPTDLAHLPPLPPPEGEARKPAKPPVSP-----KPVLTQPVPKLQGSPTPTSKKVPLP 1253
            +P P  + H P  PP        A    +P     KP +      +   PTP S      
Sbjct: 153  QPLPPIIVHQPAAPPAHIGGGPAAVVKAAPVIYKIKPSVIYQQEVINKVPTPLSLNPVYV 212

Query: 1254 GPGSPEVKRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPA----PSPARQPPA 1309
                P  K      P V+P    P +  +P    A    G A  +PA    P+PA    A
Sbjct: 213  KVYKPGKKIDAPLAPGVAPNYQQPQSYGQPQAYNAPSYGGQAYSAPAASYEPAPAPSYSA 272

Query: 1310 ALAKPPGTPPSLGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAP 1356
            A A+  G   +   S A    PGA      A  P A+ AA A   +P
Sbjct: 273  APAQSYGAAGAPSYSAAGAAGPGAAPSAAGAAAPAASYAAEAPYGSP 319


>gnl|CDD|115307 pfam06637, PV-1, PV-1 protein (PLVAP).  This family consists of
            several PV-1 (PLVAP) proteins which seem to be specific
            to mammals. PV-1 is a novel protein component of the
            endothelial fenestral and stomatal diaphragms. The
            function of this family is unknown.
          Length = 442

 Score = 30.8 bits (69), Expect = 0.75
 Identities = 40/138 (28%), Positives = 61/138 (44%), Gaps = 10/138 (7%)

Query: 1097 RQRPRGPSKGEAGVEGPPLAKVEASATLKRRIRAKQNQQ-----ENVKFILTESDTVKRR 1151
            RQ+       +A  E    A+ EA A  + +++A+  +Q     E    +  E D + + 
Sbjct: 306  RQKLEAEQAAQAAQEAKAKAEKEAQAR-EAKLQAECARQTQLALEEKAALRAERDNLAKE 364

Query: 1152 PKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEPPPTDLAHLPPL 1211
             +AK+REA  +    L++  +   T  +   S  A PP  P  PPP  PPP D A L   
Sbjct: 365  LEAKKREA-EQLRMELAIRISALDTCIK-AKSLPAMPPSRPMGPPP-NPPPIDPASLEEF 421

Query: 1212 PPPEGEA-RKPAKPPVSP 1228
                 E+ R PA  P +P
Sbjct: 422  KKKILESQRLPAGIPAAP 439


>gnl|CDD|115158 pfam06482, Endostatin, Collagenase NC10 and Endostatin.  NC10 stands
            for Non-helical region 10 and is taken from human
            collagen alpha-1(XV). A mutation in this region in human
            collagen alpha-1(XVIII) is associated with an increased
            risk of prostate cancer. This domain is cleaved from the
            precursor and forms endostatin. Endostatin is a key
            tumour suppressor and has been used highly successfully
            to treat cancer. It is a potent angiogenesis inhibitor.
            Endostatin also binds a zinc ion near the N-terminus;
            this is likely to be of structural rather than functional
            importance according to.
          Length = 290

 Score = 30.5 bits (69), Expect = 0.87
 Identities = 17/69 (24%), Positives = 22/69 (31%)

Query: 1272 PKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSP 1331
              P P  T  +P   V         PS    P +   A   + P  P +  A  A     
Sbjct: 52   LVPLPGTTDNQPPPVVLTPDPRLPDPSHLGDPRQTHSATAHRNPHPPLNSPARIAHVHQD 111

Query: 1332 GAPALHVPA 1340
              P LH+ A
Sbjct: 112  FQPVLHLIA 120


>gnl|CDD|113451 pfam04683, ARM_1, Adhesion regulating molecule conserved region.
            Family of eukaryotic proteins involved in cell adhesion.
            Members are involved in gastrulation and metastatic
            cancer formation. Experimental evidence suggests that
            members are transmembrane and possibly glycoproteins.
          Length = 360

 Score = 30.2 bits (68), Expect = 0.94
 Identities = 13/63 (20%), Positives = 22/63 (34%)

Query: 1274 PPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPSPGA 1333
                 ++    ++ A  PS ++  + +      P AA A  P    S G   +   SP  
Sbjct: 178  SSSSSSSSSRSQSAAVTPSSTSSSTRSTPAPSAPAAASATSPSPAVSSGNGSSTAASPTQ 237

Query: 1334 PAL 1336
            P  
Sbjct: 238  PIQ 240


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.310    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0688    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 12,479,962
Number of extensions: 1248331
Number of successful extensions: 6502
Number of sequences better than  1.0: 1
Number of HSP's gapped: 3668
Number of HSP's successfully gapped: 527
Length of query: 1431
Length of database: 1,940,249
Length adjustment: 96
Effective length of query: 1335
Effective length of database: 947,609
Effective search space: 1265058015
Effective search space used: 1265058015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (29.7 bits)