New window

ID: GDB90249A_62243567

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB90249A_62243567
         (842 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109831 pfam00791, ZU5, ZU5 domain.  Domain present in ZO...   162   1e-40
gnl|CDD|109582 pfam00531, Death, Death domain.                         60   7e-10
gnl|CDD|116293 pfam07679, I-set, Immunoglobulin I-set domain.          52   2e-07
gnl|CDD|109158 pfam00090, TSP_1, Thrombospondin type 1 domain.         41   3e-04
gnl|CDD|113841 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) ...    31   0.29 
gnl|CDD|110602 pfam01611, Filo_glycop, Filovirus glycoprotein.  ...    31   0.50 
gnl|CDD|116300 pfam07686, V-set, Immunoglobulin V-set domain.  T...    30   0.58 
gnl|CDD|119227 pfam10707, YrbL-PhoP_reg, PhoP regulatory network...    30   0.77 

>gnl|CDD|109831 pfam00791, ZU5, ZU5 domain.  Domain present in ZO-1 and Unc5-like
           netrin receptors Domain of unknown function.
          Length = 104

 Score =  162 bits (411), Expect = 1e-40
 Identities = 50/104 (48%), Positives = 60/104 (57%)

Query: 439 TSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTL 498
            S +  GTF+  GG L  P TG+S++IPP AIP+G  Y  YL  HK E    PL   +TL
Sbjct: 1   PSFLVSGTFDARGGSLRGPRTGVSIIIPPGAIPQGTRYTCYLVKHKKESTPPPLEEGETL 60

Query: 499 LSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEG 542
           LSP+V CGPPG L  RPVIL + HC    P  W L L +    G
Sbjct: 61  LSPLVECGPPGALFLRPVILEVPHCASLRPKEWELVLLRSDNGG 104


>gnl|CDD|109582 pfam00531, Death, Death domain. 
          Length = 83

 Score = 59.7 bits (145), Expect = 7e-10
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 761 QKIISSLDPPCRRGADWRTLAQKLHL-DSHLSFFASKP----SPTAMILNLWEARHFPNG 815
            K+ + LD     G DWR LA+KL L +S +     +     SPT  +L LWE RH  N 
Sbjct: 1   DKLCALLDEL--LGKDWRELARKLGLSESEIDEIEQENPGLRSPTYELLRLWEQRHGENA 58

Query: 816 NLSQLAAAVAGLGQPDA 832
            + +L  A+  LG+ DA
Sbjct: 59  TVGELLEALRKLGRRDA 75


>gnl|CDD|116293 pfam07679, I-set, Immunoglobulin I-set domain. 
          Length = 90

 Score = 51.9 bits (125), Expect = 2e-07
 Identities = 26/90 (28%), Positives = 36/90 (40%), Gaps = 3/90 (3%)

Query: 151 FEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNV-YITREHSLVVR 209
           F Q+P   EV   +     C    G PP  V W ++   +  S    V Y    ++L + 
Sbjct: 3   FTQKPKDVEVQEGESARFECTV-TGDPPPTVSWFKDGQPLKSSDRFKVTYDGGTYTLTIS 61

Query: 210 QARLADTANYTCVAKNIVARRRSASAAVIV 239
             +  D   YTCVA N       ASA + V
Sbjct: 62  NVQPDDEGKYTCVATNSAG-EAEASAELTV 90


>gnl|CDD|109158 pfam00090, TSP_1, Thrombospondin type 1 domain. 
          Length = 48

 Score = 41.2 bits (97), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 6/51 (11%)

Query: 246 SPWSKWSACGLDC---THWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLC 293
           SPWS+WS C + C      R R C+ P    GG  C G   +T  C  D C
Sbjct: 1   SPWSEWSPCSVTCGKGIRTRQRTCNSPF---GGPPCTGDVQETEACMMDKC 48


>gnl|CDD|113841 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) REP protein.  This
           family consists of REP proteins from Dictyostelium
           (Slime molds). REP protein is likely involved in
           transcription regulation and control of DNA replication,
           specifically amplification of plasmid at low copy
           numbers. The formation of homomultimers may be required
           for their regulatory activity.
          Length = 910

 Score = 31.3 bits (71), Expect = 0.29
 Identities = 23/92 (25%), Positives = 33/92 (35%), Gaps = 12/92 (13%)

Query: 332 EGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQ----DG 387
           E  +SD+   SI +   Q ++ +PSK  N    T     +TTTTT+Q     R+      
Sbjct: 225 EVNESDIEQISINSENIQRINSQPSKRPNN---TTTTTTTTTTTTFQPRTRKRKSIDDHK 281

Query: 388 PSP-----KFQLTNGHLLSPLGGGRHTLHHSS 414
            S      KF+        P           S
Sbjct: 282 LSLNQAPEKFKNNTKPDDDPQSDFSDKGSRKS 313


>gnl|CDD|110602 pfam01611, Filo_glycop, Filovirus glycoprotein.  This family
           includes an extracellular region from the envelope
           glycoprotein of Ebola and Marburg viruses. This region
           is also produced as a separate transcript that gives
           rise to a non-structural, secreted glycoprotein, which
           is produced in large amounts and has an unknown
           function. Processing of this protein may be involved in
           viral pathogenicity.
          Length = 364

 Score = 30.6 bits (69), Expect = 0.50
 Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 2/77 (2%)

Query: 372 TTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFVSRLSTQNY 431
             T   Q S C      SP+    +   ++ L   R +L  S+  +      +       
Sbjct: 282 NVTKQGQSSTCLSTPSLSPRTTNHSRQAVTELDKNRTSLQPSTNNTTTISTNNTSKHNFS 341

Query: 432 FRSLPRG--TSNMTYGT 446
            +S+P    T++ +  T
Sbjct: 342 TQSIPLQNFTNDNSQST 358


>gnl|CDD|116300 pfam07686, V-set, Immunoglobulin V-set domain.  This domain is
           found in antibodies as well as neural protein P0 and
           CTL4 amongst others.
          Length = 115

 Score = 30.2 bits (68), Expect = 0.58
 Identities = 19/92 (20%), Positives = 32/92 (34%), Gaps = 24/92 (26%)

Query: 158 KEVSLEQG--IVLPCRPPEGIPPAEVEWLR-----------------NEDLVDPSLDPNV 198
           + V++ +G  + LPC          V W R                 N   V P     V
Sbjct: 9   RPVTVAEGGSVTLPCTYSSSSGSTSVYWYRQPTGKGPELIIHYVTSTNNGKVGPRFSGRV 68

Query: 199 YITR-----EHSLVVRQARLADTANYTCVAKN 225
            ++      + SL +   +L+D+  YTC   +
Sbjct: 69  TLSGNGSKNDFSLTISNLQLSDSGTYTCAVSD 100


>gnl|CDD|119227 pfam10707, YrbL-PhoP_reg, PhoP regulatory network protein YrbL.
           This is a family of proteins that are activated by PhoP.
           PhoP protein controls the expression of a large number
           of genes that mediate adaptation to low Mg2+
           environments and/or virulence in several bacterial
           species. YbrL is proposed to be acting in a loop
           activity with PhoP and PrmA analogous to the
           multicomponent loop in Salmonella where the
           PhoP-dependent PmrD protein activates the regulatory
           protein PmrA, and the activated PmrA then represses
           transcription from the PmrD promoter which harbours
           binding sites for both the PhoP and PmrA proteins.
           Expression of YrbL is induced in low Mg2+ in a
           PhoP-dependent fashion and repressed by Fe3+ in a
           PmrA-dependent manner.
          Length = 201

 Score = 29.9 bits (68), Expect = 0.77
 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 10/36 (27%)

Query: 223 AKNIVARRRSASAAVIVYVDG----------SWSPW 248
             NIV  RRS     +V VDG          SWS W
Sbjct: 148 PHNIVYGRRSEGEYELVLVDGLGDKTLIPLRSWSKW 183


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.320    0.135    0.424 

Gapped
Lambda     K      H
   0.267   0.0755    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 7,333,322
Number of extensions: 702491
Number of successful extensions: 706
Number of sequences better than  1.0: 1
Number of HSP's gapped: 700
Number of HSP's successfully gapped: 10
Length of query: 842
Length of database: 1,940,249
Length adjustment: 92
Effective length of query: 750
Effective length of database: 988,969
Effective search space: 741726750
Effective search space used: 741726750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (28.8 bits)