New window

ID: GDB9948A_9257257

RPS-BLAST 2.2.19 [Nov-02-2008]

Database: Pfam.v23 
           10,340 sequences; 1,940,249 total letters

Searching..................................................done

Query= GDB9948A_9257257
         (606 letters)





                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gnl|CDD|109458 pfam00400, WD40, WD domain, G-beta repeat.              48   2e-06
gnl|CDD|117235 pfam08662, eIF2A, Eukaryotic translation initiati...    40   7e-04
gnl|CDD|113529 pfam04762, IKI3, IKI3 family.  Members of this fa...    35   0.015

>gnl|CDD|109458 pfam00400, WD40, WD domain, G-beta repeat. 
          Length = 39

 Score = 47.7 bits (114), Expect = 2e-06
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 179 FKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYD 217
            K   T+  H+  V  V FSPDGN  A+ S DG + I+D
Sbjct: 1   GKLLRTLKGHTGSVTSVAFSPDGNLLASGSDDGTVKIWD 39



 Score = 45.4 bits (108), Expect = 1e-05
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 231 KAHDGGIYAISWSPDSTHLLSASGDKTSKIWD 262
           K H G + ++++SPD   L S S D T KIWD
Sbjct: 8   KGHTGSVTSVAFSPDGNLLASGSDDGTVKIWD 39



 Score = 44.2 bits (105), Expect = 3e-05
 Identities = 12/33 (36%), Positives = 16/33 (48%)

Query: 527 VFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVW 559
              GH   +  +A+SPD    ASG  D  V +W
Sbjct: 6   TLKGHTGSVTSVAFSPDGNLLASGSDDGTVKIW 38



 Score = 41.5 bits (98), Expect = 2e-04
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 310 SKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWD 350
            K L  +KGH+ S+  +    +G  + + SGS DG +  WD
Sbjct: 1   GKLLRTLKGHTGSVTSVAFSPDG--NLLASGSDDGTVKIWD 39



 Score = 30.8 bits (70), Expect = 0.30
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 53 IYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWD 86
              H   V    ++P G  +ASG   G ++IWD
Sbjct: 6  TLKGHTGSVTSVAFSPDGNLLASGSDDGTVKIWD 39


>gnl|CDD|117235 pfam08662, eIF2A, Eukaryotic translation initiation factor eIF2A.
           This is a family of eukaryotic translation initiation
           factors.
          Length = 194

 Score = 39.5 bits (93), Expect = 7e-04
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 17/106 (16%)

Query: 168 DNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATA---SADGQIYIYDGKTGEKV 224
                FF+        ++G+  R  N + +SP G     A   +  GQI  +D K  +K+
Sbjct: 82  PAKITFFD-LNGNVIHSLGEQPR--NTIFWSPFGRLVLLAGFGNLAGQIEFWDVKNKKKI 138

Query: 225 CALGGSKAHDGGIYAISWSPDSTHLLSASG------DKTSKIWDVS 264
                S A D       WSPD  + L+A+       D   KIW  S
Sbjct: 139 ATAEASNATD-----CEWSPDGRYFLTATTSPRLRVDNGFKIWHYS 179



 Score = 29.9 bits (68), Expect = 0.53
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 11/83 (13%)

Query: 467 GNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVC------DAS----KVVTVF 516
           G   LY I  T   DE   L+ +GP+ D A+S +G   AV         +        + 
Sbjct: 37  GEFNLYLIGETGGPDEVVELDKEGPIHDFAWSPNGKEFAVIYGYMPAKITFFDLNGNVIH 96

Query: 517 SVADGYSENNVFYGHHAKIVCLA 539
           S+ +    N +F+    ++V LA
Sbjct: 97  SLGEQPR-NTIFWSPFGRLVLLA 118


>gnl|CDD|113529 pfam04762, IKI3, IKI3 family.  Members of this family are
           components of the elongator multi-subunit component of a
           novel RNA polymerase II holoenzyme for transcriptional
           elongation.
          Length = 907

 Score = 35.2 bits (81), Expect = 0.015
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 180 KFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYA 239
           K  F        +   +F  DGN+   A ADG + + +  T   +  +G     D GI A
Sbjct: 57  KVSFDEQRFVDEIISFQFLADGNQICVALADGDVILVEVDTVMDLEIVGNI---DNGISA 113

Query: 240 ISWSPDSTHLLSASGDKT----SKIWDV 263
            SWSPD   L  A+G +T    +K +D 
Sbjct: 114 ASWSPDEETLALATGLQTLLLMTKDFDP 141


  Database: Pfam.v23
    Posted date:  Mar 31, 2009  6:13 PM
  Number of letters in database: 1,940,249
  Number of sequences in database:  10,340
  
Lambda     K      H
   0.317    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0756    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 10340
Number of Hits to DB: 5,124,132
Number of extensions: 478508
Number of successful extensions: 378
Number of sequences better than  1.0: 1
Number of HSP's gapped: 373
Number of HSP's successfully gapped: 15
Length of query: 606
Length of database: 1,940,249
Length adjustment: 90
Effective length of query: 516
Effective length of database: 1,009,649
Effective search space: 520978884
Effective search space used: 520978884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (28.4 bits)